SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000009964 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000009964
Domain Number 1 Region: 340-472
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 7.85e-41
Family BCR-homology GTPase activation domain (BH-domain) 0.00015
Further Details:      
 
Domain Number 2 Region: 80-196
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000918
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000009964   Gene: ENSEEUG00000010914   Transcript: ENSEEUT00000010932
Sequence length 474
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_806:68:673369:1 gene:ENSEEUG00000010914 transcript:ENSEEUT00000010932 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQKSTNSDTSVEMLSSTCQGTGAVQMRIKNANSHHDRLSQSKSMILTDVGKVTEPXXXXX
XXXXXXXXXXXXXXXXXXMVEKEGYLQKAKIADGGKKLRKNWTTSWVVLSSQKIEFYKEA
KQQALSNMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXITTISGNEFLLQSDIDFIILDW
FHAIKNAIDRLPKDPTKTSRNRELFKIQRSSSTELLSHYDSDIKELKPEHRKSLMFRLHH
SASDTSDKNRVKSRLKKFITRRPSLKTLQEKGLIKXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXENLNLDDSQWEDIHVVTGALKMFFR
ELSEPLFPYSFFEQFVEAIKKQDNNARIETVKILVQKLPPPNRDTMKTLFGHLTKIVARA
SKNLMSTQSLGIVFGPTLLRAENDTGNMAIHMVYQNQIAELMLSEYNKIFGEED
Download sequence
Identical sequences ENSEEUP00000009964 ENSEEUP00000009964

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]