SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000010025 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000010025
Domain Number 1 Region: 163-242
Classification Level Classification E-value
Superfamily HMG-box 4.06e-21
Family HMG-box 0.00000727
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000010025   Gene: ENSEEUG00000010996   Transcript: ENSEEUT00000010999
Sequence length 388
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_937:7941:109273:1 gene:ENSEEUG00000010996 transcript:ENSEEUT00000010999 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKAPECASGMYKDSVYSAFNLLMHYPPTSGAGQHPPSSQPPMIMTSQSDQGVPQLSPLQX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFTHPSLMLGSGVP
GHPAAIPHPAIVPPSGKQELQPYDRSLKTQAEAKAEKEAKKPTIKKPLNAFMLYMKEMRA
KVIAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKK
KRRSREKHQESNTDPGSPKKCRARFGLNQQTDWCGPCRRKKKCIRYLPGEGRCPSPVPSD
DSALGCPGSPAPQDSPSYLLLPRFPTELLASPAQHRHHQFSQQLSASQPLAPHRDPAAPC
RVHRHTYRDLRDRQPSRHETCGLLGHTL
Download sequence
Identical sequences ENSEEUP00000010025 ENSEEUP00000010025

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]