SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000010171 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000010171
Domain Number 1 Region: 660-768
Classification Level Classification E-value
Superfamily Elongation factor TFIIS domain 2 1.31e-28
Family Elongation factor TFIIS domain 2 0.0047
Further Details:      
 
Domain Number 2 Region: 281-322
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000823
Family PHD domain 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000010171   Gene: ENSEEUG00000011050   Transcript: ENSEEUT00000011154
Sequence length 2207
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_8847:1499:99624:-1 gene:ENSEEUG00000011050 transcript:ENSEEUT00000011154 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDDKGDPSSEETPKAIKPTSKEFRKTWGFRRTTIAKREGAGDAELDSLDQQPQQQQSLSL
RRSGRQPKRTERVEEFLTTVRRRGRKNVPVSLEDSSEPTSCPVTDVETASEGSVESTSEM
KSGPRSGSLGMKEPLASSAKATGVDDEEDTSDSDSDGLTLKELQNRLRRKREREPSERPL
KGSQNRLRKKRREEDPAEIVDNGVSPLESSVTSKQEPWSDQGAVSQGNKEDQRDVWEGKV
AQDTKNHYAGALDQPTPESDTEXXXXXXXXXXXXXXXXXXXFMICCDRCEEWFHGDCVGI
SEARGRLLERNGEDYICPNCTILQVQDETNSEVTDQQGDKFRPIDADGIDCTSIGTIEQK
SSEDQGIKGRIEKAATPGGKKKLRIFQPVVEASGASKCIGPGCSSVAQPDSVYCSNDCIL
KHAAATMKFLSSGKEQKPKAKEKTKMKPEKPILPKCSVQXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSKEDRRVEE
KSAMAAAAPKKMALPGSSVGGKQPIPRNLLPKKSSFTNVATVKPTVKKSSGFKGTIPKRP
WLSAAPVSSASAAKQARLTPGTAMSASRKLPSSASLVGAVRKSGTTSVSLTSTPTGRLGG
TSPAPSQPNSQIRQNIRRSLKEILWKRVSDSDDLIMTENEVGKIALHIEKEMFNLFQVTD
NRYKSKYRSIMFNLKDPKNQGLFHRVLREEISLAKLVRMKPEELVSKELSMWKERPAKSV
IESRAKIHNESKKTSIKQENIPDMEDSPPVSDSDEQELVRAVPEKSAAPLLDIFSNMLKD
TTSQHRAHLFDLNCKICTGQVPSSEDEPALKKQKLSTSIKKEESKSKFEGASSEPVLNSA
DDMLPETLPENASEPELESDSPAHMERKYFPVPSGDPEPSTLEVPPYPASCVAEVVTTVT
MSGRDPRTASSGLSTAPNAARLDNTHLMEPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXISESRSPPEGDTTLFLSRLSTIWKGFINMQSVAKFVTKAYPVSGCFDYLS
EXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELCLIRFHPATEEEEVAYISLYSYFSSRG
RFGVVANNSRHVKDLYLIPLSAKDPIPSKLLPFEGPGLESPRPNIILGLVICQKMKRPSN
EEKIEEKRPRIQAPEEMETSVYPAATAPQSEKKPPKYQPSSGDIAGSTTPPDSPPPPPPL
PEPPVLKIMSSLKPGGTNTVTPSTTTVAATTVSAVNTSAPKTASPLEHILQTLFGKKKAF
DPAAKEPSTSTPTSTQDCKTKGDVLPAAPLLDPIVQQFGQLSKEKVVVEEEEDDRPYDPE
EEYGPDRVFSAQLIEPEKHQDTNKSAEAEREEVAYDPEDETILEEAKVTIDDLPNRMCAD
VKGVSSEQPTEYSAGLANPSLVEQQKMIEELNKQIEEQKRQVEEQEEALRQQRAAVGVSM
AHFSVSDALMSPPPKSVLPKAELFPQEQQAAGKSAIPPASGQAAARRDPRQARRLAVEIN
EGEVNLKPAALREAAEGVASRAIIPEETGPQPWIPGEEALLPTPQGGHTESPAQPPGDGA
FPLATGGDCVARPARKVLLPTPPCPAFQPHFPLQGDGQREPFSGPVFTSQEMALGSAPYE
DPRNVQFAEKGDNLVTEMEGNRDPQSRPGEGPTMFPTPGHKTGPPPQFQGMREPVPRTFG
MSGLHGPSFPGPRGPAPPFPEENAILSNDGPRGPPPARFGAQKGPIPSLFSGQQGPPPYG
DNRGPSPSYLGGPRGATPPQFEERKDSHGEKREFQDAPYNEMTGPPAQFEGPDQAPFMGN
RGTTPFQYGGQRRPLLSQFKGPRGGPPPSQFGGQRGPPPGHYVGPRGPHPGQFETARGPH
PNQFEGPRGQAPNFMPGPRGMQPQQFEEQRVNSPPRFANQRAPAPLQFGGPRGSAPFPDK
NEQGPPRFHFQGQALQKPGPRPLLDLPSHPPQHRKDRWDEGGPPSLPAGGPGPSPEMDTQ
WASSDFHEGKGHDYRNQTFEGRPRERFEAGPKEKAAEDPEVPPPDTRQGRAFEDRGRDRE
RGRNWSRERDWDRGREWDRYREKDREWDKGRERSTGRDKERDWERSRNRDRDRDRDRRRD
RDRSRSRDRDRDKARDRDRGRDRKDRSKSKENTREPKVDTPRADGQS
Download sequence
Identical sequences ENSEEUP00000010171 ENSEEUP00000010171

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]