SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000010289 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000010289
Domain Number 1 Region: 477-671
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.12e-55
Family BCR-homology GTPase activation domain (BH-domain) 0.0000666
Further Details:      
 
Domain Number 2 Region: 2-140
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 4.19e-27
Family FCH domain 0.007
Further Details:      
 
Domain Number 3 Region: 202-314
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 9.42e-25
Family FCH domain 0.011
Further Details:      
 
Domain Number 4 Region: 723-783
Classification Level Classification E-value
Superfamily SH3-domain 4.99e-16
Family SH3-domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000010289   Gene: ENSEEUG00000011249   Transcript: ENSEEUT00000011279
Sequence length 1061
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_8341:17884:202064:1 gene:ENSEEUG00000011249 transcript:ENSEEUT00000011279 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IRAQLVEQQKCLEQQTEMRVQLLQDLQDFFRKKAEIETEYSRNLEKLAERFMAKTRSTKD
HQQYKKDQNLLSPVNCWYLLLNQVRRESKDHATLSDIYLNNVIMRFMQISEDSTRMFKKS
KEIAFQLHEDLMKVLNELYTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXRQAKYSENKLKSIKARNEYLLTLEATNASVFKYYIHDLS
DLIDCCDLGYHASLNRALRTYLSAEYNLETSRHEGLDIIENAVDNLEPRSDKQRFMEMYP
AAFCPPMKFEFQSHMGDEVCQVSAQQPVQAELMLRYQQLQSRLTTLKIENEEVKKTTEAT
LQTIQDMVTIEDYDVSECFQHSRSTESVKSTVSETYLSKPSIAKRRANQQETEQFYFMXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXHRAEYMTTRPPNVPPKPQKHRKSRPRSQYNAKL
FNGDLETFVKDSGQIIPLIVESCIRFINLYGLQHQGIFRVSGSQVEVNDIKNSFERGENP
LADDQSNHDINSVAGVLKLYFRGLENPLFPKERFNDLISCIRIDNLYERALHIRKLLLTL
PRSVLIVMRYLFAFLNHLSQYSDENMMDPYNLAICFGPTLMPIPDIQDQVSCQAHVNEIV
KTIIIHHETIFPDAKELDGPVYEKCMAGDDYCDSPYSEHGTLEEVDQDAGTEPHTSEDEC
EPIEAIAKFDYVGRSARELSFKKGASLLLYHRASDDWWEGRHNGIDGLVPHQYIVVQDMD
DTFSDTLSQKADSEASSGPVTEDKSSSKDMNSPTDRHSDSYLARQRKRGEPPPPVRRPGR
TSDGHCPLHPPHALSNSSIDLGSPNLSSHPRGLLQNRGLNNDSPERRRRPGHGSLSNISR
HDSLKKIDSPPIRRSTSSGQYTSFNDHKPLDPETIAQDIEETMNTALNELRELERQSTAK
HAPDVVLDTEQVKNSPAPATSMESLSPLHSVALRSSEPQIRRSTSSSSDTMSTFKPMVAP
RMGVQLKPPALRPKPAVLPKTNPTIGPAPPSQGPTDKSCTM
Download sequence
Identical sequences ENSEEUP00000010289 ENSEEUP00000010289

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]