SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000010293 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000010293
Domain Number 1 Region: 279-433
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.42e-42
Family Reprolysin-like 0.0011
Further Details:      
 
Domain Number 2 Region: 524-575
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000693
Family TSP-1 type 1 repeat 0.00042
Further Details:      
 
Domain Number 3 Region: 808-865
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000115
Family TSP-1 type 1 repeat 0.0037
Further Details:      
 
Domain Number 4 Region: 869-925
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000196
Family TSP-1 type 1 repeat 0.0033
Further Details:      
 
Domain Number 5 Region: 928-983
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000366
Family TSP-1 type 1 repeat 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000010293   Gene: ENSEEUG00000011241   Transcript: ENSEEUT00000011283
Sequence length 1083
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_3080:3615:234596:-1 gene:ENSEEUG00000011241 transcript:ENSEEUT00000011283 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EFLSYLEHYQLTIPIRVDQNGAFLSFTVKNDKHSRRRRSMDPVDPLQAASKLFFKLSAYG
KHFHLNLTLNTDFVSKHFTVEYWGKDGPQWKHDFLDNCHYTGYLEDQRSTTKVALSNCIG
LHGVIATEDEEYFIEPLKNTTEDSKHFSYENGHPHVIYKKSTLQQRHLYDHSHCGVSDLI
RSGRSWWLNDSSAFPSSLSTNGTSIYHRQKRSXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPNEINHHADKSLDSFCKWQKSILS
HQSDGNTIPENGIAHHDNAVLITRYDICTYKNKPCGTLGLASVAGMCEPERSCSINEDIG
LGSAFTIAHEIGHNFGMNHDGIGNSCGTKGHEAAKLMAAHITANTNPFSWSACSRDYITS
FLDSGRGTCLDNEPPKRDFLYPAVAPGQVYDADEQCRFQYGAASRQCKYGEVCRELWCLS
KSNRCVTNSIPAAEGTLCQTGNIEKGWCYQGDCVPFGTWPQSLDGGWGPWSLWGECSRTC
GGGVSSSLRHCDSPAPSGGGKYCLGERKRYRSCNTDLCPLGSRDFREKQCADFDNMPFRG
KYYNWKPYTGGGVKPCALTRLAEGYNFYTERAPAVIDGTQCNADSLDICINGECKHVGCD
NILGSDAREDRCRVCGGDGSTCDAIEGFFNDSLPRGGYMEVVQIPRGSVHIEVREVSMSK
NYIALKSEGDDYYINGAWTIDWPRKFDVAGTAFHYKRPTDEPESLEALGPTSENLIVMVL
LQEQNLGIRYKFNVPITRTGSGDNEVGFTWNHQPWSECSATCAGGIQRQEVVCKRLDDNS
IVQNNYCDPDSKPPENQRACNTEPCPPEWFIGDWLECSKTCDGGMRSRAVLCIRKIGPSE
EETLDYSGCLTHRPIEKELCNNQSCPPQWVALDWSECTPKCGPGFKHRIVLCKSSDLSKT
FPAAQCAEESKPPVRIRCSLGRCPPPRWVTGDWGQXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXCKDVNKVAYCPLVLKFKFCSRAYLRQMCCKTW
QGH
Download sequence
Identical sequences ENSEEUP00000010293 ENSEEUP00000010293

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]