SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000010548 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000010548
Domain Number 1 Region: 192-229
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000159
Family PHD domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000010548   Gene: ENSEEUG00000011558   Transcript: ENSEEUT00000011563
Sequence length 817
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_1546:873:103654:1 gene:ENSEEUG00000011558 transcript:ENSEEUT00000011563 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRQRTLSSSDSSDECPSTSFTPSSVYRSRSKIPNERKKSAEVFRKDLISAMKLPDSHHI
NPDSYYLFADTWKEEWEKGVQVPANPDTLPQPSLRVMSEKVKDVLYVRPRKYIHCSTPET
AEPGYINIMELAASVCRYDLDDMDIFWLQELNEILIEMGCNRVDEDLMEKTIEVLERQCH
ENMNHAIETEEGLGIEYDEDVICDVCRSPDSEEGNDMVFCDKCNICVHQXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXCSVKSCITAFHVTCAFEHNLEMKTILDEVDEVKFKS
YCLKHSQNRQKLGEAEYALHRATEQNQAKKTSLRAQKLRELEEEFYSHVHEDVETLPALV
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVRNLC
YMISRREKLKLSQTKMQEQIFSLQVQLNNQEIAAGLPLTFPANPVENTLFSPPPRITLKL
KMPKSTSEESKNSSAEPDYGLLSPSSSSPAQNVRSKQESLEIKMKPYPRYPLESKNNCLL
ASLSHSRSEAKDASPAWRTVSPEFYHEQSLGKPLVLQAALHGQSSIGNGKSQPTSKFAKS
NGLDGSWSGDVSQKDNPKEMFGDREPVLSPQLASQGSFRKSTVDHFSKSFKEATNRWVRS
TEELQCCVKPTKNVSPKEQLWGKQLVRRSAGRAPYPENDGYCPDLELSDSEPESDGNKEK
VRVRRDSSDRENPPHDSRRECRSKSKPHPLSHSSMQR
Download sequence
Identical sequences ENSEEUP00000010548 ENSEEUP00000010548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]