SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000010585 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000010585
Domain Number 1 Region: 212-350
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 8.24e-28
Family BCR-homology GTPase activation domain (BH-domain) 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000010585   Gene: ENSEEUG00000011583   Transcript: ENSEEUT00000011602
Sequence length 568
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_1096:7594:127358:1 gene:ENSEEUG00000011583 transcript:ENSEEUT00000011602 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRKKNKQSVRDVRDIFGVSESPPGDTCDNHTAQEDGAQEDKELPRVIKTDEPLXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXSILETIPDMPVHTNGSPGPGQSVQNAVRDDNYLEKNI
SPETEELSFEVSYSEMITEVPKRNKFKKSDFKKEDYALTKFIVQKTRFGLTEAGDLSAED
MKKSRHLSLIELTPFIDAYGIQLSGPQKVKGRDNGIFGVPLAVLLDNDRKKDPGVKVPLV
LQKFFEKVEESGLESEGIFRLSGCTAKVKQYREELDTRFNADKFKWDKMCHREAAVMLKA
FFRELPTSLFPVEYIPAFISLLERGPHIKVQFQALHLMIMALPDVNRDTAQXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVPS
FLITQVRRMNEATLLLKKQLPSVKKLLRRKTIEREXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHSSSECLKIQNQRLYEIGGNIGQH
CLDPDAYILDVYHINPQAEWVIKPQPNF
Download sequence
Identical sequences ENSEEUP00000010585 ENSEEUP00000010585

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]