SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000010815 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000010815
Domain Number 1 Region: 560-667
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 4.46e-23
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0023
Further Details:      
 
Domain Number 2 Region: 152-296
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.07e-16
Family G proteins 0.014
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000010815
Domain Number - Region: 22-115,421-470,604-626
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00118
Family Growth factor receptor domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000010815   Gene: ENSEEUG00000011845   Transcript: ENSEEUT00000011851
Sequence length 700
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_2848:52828:94171:-1 gene:ENSEEUG00000011845 transcript:ENSEEUT00000011851 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAQTCPVQKGQNPGLMCQESYVCSGTDQAVFECDECCSLQCLRCEEVLHRQERMRNHER
IRLKPGHVPYCDPCKGPDGHSPSVRQRAAVRCQTCKMDLCLECQKRTHSGGSKRKHPVTV
YHVAKAQESLEDKELDEETKRKKMTEKVVSFLLVDENEEIQVTNEEDFIRKLDCRPDQLL
KVVSIFGNTGDGKSHTLNHTFFHGREVFKTSPAQESCTVGVWAAYDPVHRVAVIDTEGLL
GATVNLSQRTRLLLKVLAISDLVIYRTHADRLHNDLFKFLGDASEAYLKHFTKELKATTA
RCGLDVPLSTLGPAVIIFHETVHTQLLGSDHPSEAPEKLIQDRFRKLGRFPEAFSSIHYK
GTRTYNPPTDFSGLRRALEQQLENNTTRSPRHPGVIFKALKALSDRFSGEIPDDQMAHSS
FFPDEYFTCSSSCLSCGAGCQNSMNHGKEGLPHEAKSRCSYSHQYDNRVFTCKACYERGK
EVSVVPKTSASTDSPWMGLAKYAWSGYVIECPHCGVVYRSRQYWFGNQDPVDTVVRTEIV
HVWPGTDGFLKDNNNAAQRLLDGMNFMAQSVSELSLGPTKAVTSWLTDQIAPAYWRPNSQ
ILSCSKCATSFKDNDTKHHCRACGEGFCDGCSSKTRPVPERGWGLAPVRVCDNCYEARSV
QLDVAETQAEEEGGTLIARKVGEAVQNTLGAVVTAIDIPL
Download sequence
Identical sequences ENSEEUP00000010815 ENSEEUP00000010815

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]