SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000010821 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000010821
Domain Number 1 Region: 925-1195
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.58e-72
Family Tandem AAA-ATPase domain 0.0000223
Further Details:      
 
Domain Number 2 Region: 332-383
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 3.77e-16
Family PHD domain 0.0017
Further Details:      
 
Domain Number 3 Region: 406-463
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000000221
Family PHD domain 0.0000927
Further Details:      
 
Domain Number 4 Region: 851-933
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000000863
Family Tandem AAA-ATPase domain 0.0048
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000010821
Domain Number - Region: 139-177
Classification Level Classification E-value
Superfamily HMG-box 0.00299
Family HMG-box 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000010821   Gene: ENSEEUG00000011777   Transcript: ENSEEUT00000011857
Sequence length 1785
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_144:122911:182112:-1 gene:ENSEEUG00000011777 transcript:ENSEEUT00000011857 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NEEDPEEDLSEAETPKLKKKKKPKKPRDPKIPKSKRQKKERLLLCRQLGDSSGEGPEFVE
EEEEVALRSDSEGSDYTPGKKKKKKLGPKKEKKSKSKRKEEEEEEDEDDDSKEPKSSAQL
LEDWGMEDIDHVFSEEDYRTLTNYKAFSQFVRPLIAAQNPKIAVSKMMMVLGAKWREFIN
NNPIKSSSGASVAAAAAAAVAVVESMVTATXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXEEEVTAVDGYETDHQDYCEVCQQGGEIILCDTCPRAYHM
VCLDPDMEKAPEGKWSCPHCEKEGIQWEAKEDNSEGEEILEEVGGDPEEEDDHHMEFCRV
CKDGGELLCCDTCPSSYHIHCLNPPLPEIPNGEWLCPRCTXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXFFRVLNGYSLQHKLLLTGTPLQNNLEELFHLLNFLTPERFHNLEGFLEEF
ADIAKEDQIKKLHDMLGPHMLRRLKADVFKNMPSKTELIVRVELSPMQKKYYKYILTRNF
EALNARGGGNQVSLLNVVMDLKKCCNHPYLFPVAAMEAPKMPNGMYDGSALIRASGKLLL
LQKMLKNLKEGGHRVLIFSQMTKMLDLLEDFLEHEGYKYERIDGGITGNMRQEAIDRFNA
PGAQQFCFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQNKKVMIYRF
VTRASVEERITQVAKKKMMLTHLVVRPGLGSKTGSMSKQELDDILKFGTEELFKDEATDG
GGDNKEGEDSSVIHYDDKAIERLLDRNQDETEDTELQGMNEYLSSFKVAQYVVREEEMGE
EEEVEREIIKQEESVDPDYWEKLLRHHYEQQQEDLARNLGKGKRIRKQVNYNDGSQEDRG
VCGRPRPPPMGRSTRAVGPAHLPSLPPDWQDDQSDNQSDYSVASEEGDEDFDERSEAPRR
PSRKGLRNDKDKPLPPLLARVGGNIEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXAYVSLFMRHLCEPGADGAETFADGVPREGLSRQHVLTRIGVMSLIRKKV
QEFEHVNGRWSMPELAEVEENKKMSQPGSPSPKTPTPSTPGDTQPNTPAPAPPTEDGVKV
EENNLKEEETTEGEKDVKPAAPETTAECTQPPASAPAIEDEKVLAELPEGEEKVEKAXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMFLKPSDLWPRRPDSRLLAGI
INHAYARWQDIQNDPRYAILNEPFKGEMNRGNLEIKNKFLARRFM
Download sequence
Identical sequences ENSEEUP00000010821 ENSEEUP00000010821

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]