SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000011007 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000011007
Domain Number 1 Region: 138-346
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 2.2e-39
Family Hypoxia-inducible factor HIF ihhibitor (FIH1) 0.07
Further Details:      
 
Domain Number 2 Region: 48-97
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000126
Family PHD domain 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000011007   Gene: ENSEEUG00000011963   Transcript: ENSEEUT00000012068
Sequence length 1054
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_7126:10524:98832:-1 gene:ENSEEUG00000011963 transcript:ENSEEUT00000012068 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGSHXXXXXXXXXXPSTSLEPRNPAAPPTLLNARTASGLACLSPHFYTLFLIDCACQDG
FHGSCVGVEEEKAADIDLYHCPNCTVLHGPSIMKKRRVSSKGHDSQKGKPVKTGSPIFIR
ELRSRTFVSSDEVILKPTGSQLTVEFLEENSFSVPILVMKKDGLGMTLPSPSFTVRDVEH
YVGSDKEIDVIDVTRQADCKMKLGDFVKYYYSGKREKVLNVISLEFSDTRLSNLVETPKI
VRKLSWVENLWPEECVFERPNVQKYCLMSVRDSYTDFHIDFGGTSVWYHVLKGEKIFYLI
RPTNANLTLFECWSSSSNQNEMFFGDQVDKCYKCSVKQGQTLFIPTXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRENRRHP
ASYLVHGGKALNLAFRAWTKKEALPDHEDEIPETVRTVQLIKDLAREIRLVEDIFQQNVG
RTNNIFGLQRIFPAGSIPLTSPAHSTSMPMSRLSLPSKSDSKKKVLKPKKLFKKAEQKGK
EGSALGPASHLSYNLMDTYNHQTLKTVSSQKAKFNIAGACLNDTDDDSPDLDLDNEGPLG
LLMSNGSVKRMKGLSKSRRAKIAKKAEKARLIAERVMEDEFDWDSDDELQIDERLGKEKA
TLIIRPKFPRKLPRAKPCSDPNRVREPGEVEFDIEXXXXXXXXXXXXXXXXXXXXXXXXX
XXDLLKASRQVGGPDYATLTEAPASPSTQEAIQGMLCMANLQSSSSSPATSSLQAWWTGG
QDRSSGSCSSGLGTISSSPASQRTPGKRPIKRPAYWRTESEEEENASMDEQESLGACFKD
AEYIYPSLESDEDDPALKSRPKKKKNSDDAPWSPKARVTPTLPKQDRPVREGTRVASIET
GLAAAAAKLAQQELQKTQKKKYIKKKPLLKEVEQPCPQESNISVATPAPAPVPALQLSSS
YSHWPPPGLKQEVLFGKPLAEQECTARSNAFGMAQANRNTTPMAPGVFLTQRRPSGGTQS
NQTGQGKRPKKGLATAKQRLGRILKIHRNGKLLL
Download sequence
Identical sequences ENSEEUP00000011007 ENSEEUP00000011007

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]