SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000011104 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000011104
Domain Number 1 Region: 812-934
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 7.44e-30
Family Synaptotagmin-like (S variant) 0.00000108
Further Details:      
 
Domain Number 2 Region: 26-68,117-193
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.1e-21
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.011
Further Details:      
 
Domain Number 3 Region: 1258-1319
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000000000193
Family Synaptotagmin-like (S variant) 0.02
Further Details:      
 
Domain Number 4 Region: 719-758
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000222
Family PDZ domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000011104   Gene: ENSEEUG00000012141   Transcript: ENSEEUT00000012174
Sequence length 1319
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_7373:241:243727:1 gene:ENSEEUG00000012141 transcript:ENSEEUT00000012174 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAPGAPRGRPAAPPPPVQPELPDLSHLTDEERRIILAVMDRQKKEEEKEQVKEEHKPQS
TQWFPFSGITELVNNVLQPQQKQQNEKEPQTKLHQQFEMYKEQVKKMGEESQQQQEQKGD
APTCGICHKTKFADGCGHNCSYCQTKFCARCGGRVSLRSNKVMWVCNLCRKQQEILTKSG
AWFYNSGCNMPQQPDPKVLCGLRNEEAPQEKKAKLHEQAQFPGPPGDLPVPAVEKSRSHG
LTRQDSIQNGSGMKHQIASDIASDRKRSPSVSRDQNRRYDQREEREEEYSQYATSDSAMP
RSPSDYTDSRSHHEPQFYEESDHMNYRDSNRRSHRHSKEYIEDDEDVESRDEYERQRREE
EYQARYRSDPNLARYPVKPQPYEEQMRIHAEVSRARHERRHSDVSLANAELEDSRIPMLR
MDRPSRQRSISERRAALENQRSYSMERTRETQGPSSYPQRTTNHSPPTPRRSPIPIDRPD
MRRTDSLRKQHHLDPSSAVRKTKREKMETMLRNDSLSSDQSESVRPPPPKPHKSKKGGKM
RQVSLSSSEEELASTPEYTSCDDVEIESESVSEKXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHPVTWQPSKDGDCLIG
RILLNKRLKDGSVPRDSGAMLGLKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDE
VLEWNGRLLQGATFEEVYNIILESKPEPQVELVVSRPIGXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIKLWFDKVGHQLIVTILGAKDLPSREDG
RPRNPYVKIYFLPDRSDKNKRRTKTVKKTLEPKWNQTFIYSPVHRREFRERMLEITLWDQ
ARVREEESEFLGEILIELETALLDDEPHWYKLQTHDVSSLPLPHPSPYLSRRQLHGESPT
RRLQRSKRISDSEVSDYDCDDGVGVVSDYRHIGRDLQSSALSVPEQVMSSNHCSPTGSPH
RADAIGRIRSWSPNAPPPQSRNVEQGLRGTRSTTGHYNTISRMDRHHVMDDHYSPDRDRD
CEAADRQPYHRSRSTEQRPLLERTTTRSRSTERPDTNLMRSMPSLMTGRSAPPSPALSRS
HPRTGSVQTSPSSTPVAGRRGRQLPQLPPKGTLERXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXLIFPGVRLASDSQFSDFLDGLGPAQLVGRQTLATPAM
GDIQVGMMDKKGQLEVEIIRARGLVVKPSKTLPAPYVKVYLLDNGVCIAKKKTKVARKT
Download sequence
Identical sequences ENSEEUP00000011104 ENSEEUP00000011104

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]