SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000011121 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000011121
Domain Number 1 Region: 32-192
Classification Level Classification E-value
Superfamily PH domain-like 1.51e-32
Family Pleckstrin-homology domain (PH domain) 0.00022
Further Details:      
 
Domain Number 2 Region: 277-348
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.84e-18
Family BCR-homology GTPase activation domain (BH-domain) 0.0014
Further Details:      
 
Domain Number 3 Region: 151-217
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.00000000000732
Family BCR-homology GTPase activation domain (BH-domain) 0.0046
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000011121
Domain Number - Region: 620-688
Classification Level Classification E-value
Superfamily Tropomyosin 0.00101
Family Tropomyosin 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000011121   Gene: ENSEEUG00000012196   Transcript: ENSEEUT00000012192
Sequence length 705
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_3395:5070:174646:-1 gene:ENSEEUG00000012196 transcript:ENSEEUT00000012192 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSPKIRQARRARSKSLVMGEQSRSPGRPSCPRRLGPVLKAGWLKKQRTIMKNWQQRWFV
LRGDQLFYYKDKDETKPQGFISLQGTQVTELLPGPDDPGKHLFEISPGGAGEREKVPANP
EALLLMASSQRDMEDWVQAIRRVIWAPFGGGIFGQRLEDTVHHERKYGPRLAPLLVEQCV
DFIRERGITEEGLFRMPGQANLVRDLQDSFDCGEKPLFDXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXGTLELTKQVSSLPLHYNLLRYICKFLDEVQSHSNVN
KMSVQNLATVFGPNILRPQIEDPVTIMEGTSLVQHLMTVLIRKHNQLFTARATEVPASPR
GGPPCTVGWGSEEVARDSQTEPGSPCDPGLPSQRTSSLDGATVAALSRNSSSGLGSRSSP
AVTSPGKKVQTLPNWKSSFRQAGSRSGSPKVGSSSLEVPIISSGGNWLMNGLSSLRGHRL
ASSGDRLKDSGTVQRLSTYDNVPPPSLFPSTPSVTSIAWSAASSCEASAQGSVSSCTACR
ASDSSVCSSLHTEGALEPSPFPSSSEDQRSPDPGHSLDEVGTCISSSEPSDPGSPTREHT
RHSEALHSLIMELRAELYRQRTEYQTSMKRTEEGSSSLKQRMSQLEEELDQEKKKYTMLE
IKLRNSERAREDAEKRNQLLQKEMEEFFSTLGSLTVGAKEARTPE
Download sequence
Identical sequences ENSEEUP00000011121 ENSEEUP00000011121

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]