SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000011192 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000011192
Domain Number 1 Region: 2232-2279
Classification Level Classification E-value
Superfamily SET domain 0.000000000000899
Family Histone lysine methyltransferases 0.022
Further Details:      
 
Domain Number 2 Region: 2570-2602
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000448
Family PHD domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000011192   Gene: ENSEEUG00000012203   Transcript: ENSEEUT00000012268
Sequence length 2965
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_5790:16403:125132:-1 gene:ENSEEUG00000012203 transcript:ENSEEUT00000012268 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDHRNTAMLGLGSDSEGFSRKSPSAINTGTLVSKREIELESNTKEEEDLLKWNRERKTEA
GKDDCLAAAQQQFSVKETNFSEGNLKLKIGLQAKRTKKPPKNLENYVCRPAIKTTIKHPR
KTLKSGKMTDEKNEHCPSKRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXSHENQDISESMKDSAGKIFEKNVLRQSKENILEKF
SVRREINNLEKQMFNEGTCIQQDSFSPIERGPYEISKHEKQPPVYCTSPDFQMGGASDMS
TAKSPFSAVGESNLPSPSPTVSVNPLTRNSPETSSQMAHNPLHLSPTTDLMEDISESVGK
RQFTSESTHLNISHRSMGHSINIECKGIDKELNDSRTTHIDIPRISSSLGKKPSLTSESS
IHTITPSVVNFTSLFSNKPFLKLGAVAASDKHCQVTESLSSSLQSKPLKKRKGRKPRWTK
VVARSTCRSPKGLELERSELFKNVSCSSLSSSNSEQAKFMKNIGSSSFVDHDFLKRRLPK
LSKSTTPSLALLTDSEKTSHKSFATHKLSSSMCVSSDLLSDIYKPKRGRPKSKEMPQLEG
PPKRTLKIPASKVFSLQSKEEQEPPILQPEIEIPSFKQSISLSPFPKKRGRPKRQMRSPV
KMKPPVLSVAPFVATESPSKIESESDNHRSSSDFFESEDQLQDPDDLDDSHRSTVCSMSD
LEMEPDKKITKRNNGQLMKTIIRKINKMKTLKRKKLLNQILSSSVESSKGKVQSKLHNTV
SSLAATFGSKLGQQINVSKKGTIYIGKRRGRKPKTVLNGLLSGSPTSLAVLEQTAQQAAG
SALGQILPPLLPSSASSSEILPSPICSQSSGTSGGQSPVSSDAGFVEPSSLPYLHLHSRQ
GSMIQTLAMKKASKGRRRLSPPTLLPNSPSHLSELTSLKEATPSPISESHSDETIPSDSG
IGTDNNSTSDRAEKFCGQKKRRHSFEHVSLIPPETSTVLSSLKEKHKHKCKRRNHDYLSY
DKMKRQKRKRKKKYPQLRNRQDPDFIADLEELISRLSEIRITHRSHHFIPRDLLPTIFRI
NFNSFYTHPSFPLDPLHYIRKPDLKKKRGRPPKMREAMAEMPFMHSLSFPLSSTGFYPSY
GMPYSPSPLTAAPIGLGYYGRYTPTIYPPPPSPSFTTPLPPPSYMHAGHLLLNPTKYHKK
KHKLLRQEAFLTTSRTPLLSMSTYPSVPPEMAYGWMVEHKHRHRHKHREHQFSEQPQVSM
DTGSSRSVLESLKRYRFGKDTVGERYKHKDKHRCHMSYPHLSPSKSLINREEQWVHREPS
ESSSLTLGLQTPLQIDCSESSPSLSLGGFTPNSDPASNDEHTNLFTSAIGSCRVSNPNSS
GRKKLTDSPGLFSAQDTSLNRPHRKEPLPSSERAVPTLTXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXNGVPSRSPRLVVSGDESVDSLLQRMVQHEDQDPLEKNIDAVIASVS
VPPSSSPGHIHNKERTLSKSDSLLVPAVPSDSCSNSISLLSEKLPSSCSPHHIKRSVVEA
MQRQARKMCNYDKILATKKNLDHVNKILKAKKLQRQARTGNNFVKRRPGRPRKCPLQAVV
SMQAFQAAQFVNSELNEVEEGTALHLNPDTVTDVIEAVVQSVNLNPEHKKGLKRKSWLLD
EQTKKKQKPFPEGGGGEEENTKSFSDAAVEILSPPEVPAKPSEPENTLQSVLSLIPREKK
TPRPPKKKYQKAGLYSDVYKTADPKSRLIQLKKEKLEYTPGEHEYGLFPAPIHVVFFVSG
YLRQKRIDFQLPYDILWQHNQLYKKPDVPLYKKIRSNVYVDVKPLSGYEATTCNCKKPDD
DIRKGCMDDCLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXSVNGVYRIGLYALKDMPAGTELTYDYNFHSFNVEKQQLCKCGFEKCRGI
IGGKSQRMNGLTSSKTSQPMNTHKKSGRSKEKRKSKHKLKKRRGHLSEEPSESINTPTRL
TPQLQMKPMSNRERNFVLKHHVFLVRNWEKIRQKQEEVKHTNDNIHSASLYTRWNGMCRD
DGNIKSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSS
RQALAAPLLNLPPKKKNADYYEKISDPLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
KYYGRKSPIGRDVCRLRKAYYNARHEASAQIDEIVGETASEADSSETSVSEKENGHEKDD
DVIRCICGLYKDEGLMIQCDKCMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEVPMIPRP
HYAQPGCVYFICLLRDDLLLRQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXRFAFGHHYFRPHEHHSPSRRFYHNELFRVPLYEIIPLEAVVETCCVLDL
YTYCKGRPKGVKEQDVYICDYRLDKSAHLFYKIHRNRYPVCTKPYAFDHFPKKLTPKRDF
SPHYVPDNYKRNGGRSSWKSERSKPPLKDLGQEDDALPLIEEVLASQEQAANEMPGLEER
EQEGGTTDISENEKKTEENSQEPQPACTPEERRHNQRERLNQILLNLLEKIPGKNAIDVT
YLLEEGSGRKLRRRTLFMPEHSFRK
Download sequence
Identical sequences ENSEEUP00000011192 ENSEEUP00000011192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]