SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000011232 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000011232
Domain Number 1 Region: 47-117
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000000268
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000011232   Gene: ENSEEUG00000012318   Transcript: ENSEEUT00000012315
Sequence length 296
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_7619:9248:45644:-1 gene:ENSEEUG00000012318 transcript:ENSEEUT00000012315 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADTIFSSGNDQWVCPNDRQLALRAKLQTGWSVHTYQTEKQRKSQCLSPTEVDTILQVIQ
RAERLDVLEQQRIGRLVERLETMRRNVLGNGLSQCLLCGELLGFLGSSSVFCKDCRKXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXVWKRSGAWFYKGLPKYILPLKTPGQADDPHLRPQ
PLEPTQQEPRSTETSRVYTWARGRVVSSDSDSDSDLSSSSLEDRLPPXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXASGTPGQVHAADTAPSNPCL
Download sequence
Identical sequences ENSEEUP00000011232 ENSEEUP00000011232

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]