SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000011380 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000011380
Domain Number 1 Region: 171-248
Classification Level Classification E-value
Superfamily HMG-box 1.14e-16
Family HMG-box 0.002
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000011380
Domain Number - Region: 776-796
Classification Level Classification E-value
Superfamily Rubredoxin-like 0.08
Family Rubredoxin 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000011380   Gene: ENSEEUG00000012435   Transcript: ENSEEUT00000012478
Sequence length 1441
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_5499:46627:113677:1 gene:ENSEEUG00000012435 transcript:ENSEEUT00000012478 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WRSEVLECYSRCRCLCRRLAGAPATPLSLLISPGSLGPRQASLSLRSHPGFPHTLRPPYR
DSQEEERGGLSRLRAVCRRAGPRGRGSSSPRDARASPRLPVPAAPGAIGAACRRLRGARV
RRRSARSSSPRAGRRRECEPRGSHAARAMDASYDGTEVTVVMEEIEEAYCYTSPGPPKKK
KKYKIHGEKAKKPRSAYLLYYYDIYLKVQQELPHLPQSEINKKISESWRLLSVAERSYYL
EKAKLEKEGLDPNSKLSTLTAVVPDIPGFRKILPRSDYIIIPKSSLQEDRSCPQLELCVA
QNQMSSKGSSLVPNTALETVSSHAGMAEQCLAVEALAEEVGSLAQPGAVQEIATSEILSQ
DMLLEEASLEVRESHQAYQTSLVIEESLVNDSPDLPTGSLAVPHAQVGESMSVVTVMRDS
TESSSSAPATQFIMLPLPAYSVVENPTSIKLTTTYTRRGHGTCTSPGCSFTYVTRHKPPK
CPTCGNFLGGKWIPKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVDLLSPGPRAPELKGRARGKPSLLA
AARPMRAILPAPTNVGRGGSMGLPRARQAFHLSDKTSSVRTCGLKPSTLKQLGQPVQQPS
NTGEVKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLGLATSRGRGKCKNPSCSYV
YTNRHKPRICPSCGFNLAKDRTEKTTKALEVSSPLPEVLSAREPLSAPQREIQRQSTLQL
LRKVLQIPENESELAEVFALIQELNSSRLILSNVSEETVTIEQTSWSNYYESPSTQCLLC
SSLLFKGGQNSLAGPQECWLLTANRLQVVTAQVKMCLNPHCLALHSFMDIYTGLFNVGNK
LLVSLDLLFAIRNQIKLGEDPRVSVNTVLKSVQEQTEKTLTPEELRQLQELLCNGYWAFE
CLTVRDYNDMICGICGVAPKVEMAQRSEENVLALRSVEFTWPEFLSSNEVNAEDFWATME
TEAIEQVAFPTSIPITKFDASVIAPFFPPLMRGAVVVNTERDKNLDLQPAPGDGSALVRL
LQEGACRVEELSSYSEEDLRHLLQQCSIPFREEDSKDQLCFSLLALYKSIQNGSRARQPP
PHLTGGKIYKVCPHQVVCGSKYLVRGESALDHVDLLASSRHWPPVYVVDMATPVALCADL
CYPELTNGMWGRNQGCFSSPTEPPVNVSCPELLDQHYAVDITEAEHSFQHPVTKTTTRRI
VHAGTQPSPDDPSAEHHSLALCPELAPYAAILASISDSKPHSVRQRPIAFDNATHYYLYN
RLMDFLTSREIVNRQIHDVVQSCQPGEVVIRDTLYRLGVAQIKTETEEEGEDEEAAVSAE
M
Download sequence
Identical sequences ENSEEUP00000011380 ENSEEUP00000011380

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]