SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000011397 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000011397
Domain Number 1 Region: 213-306
Classification Level Classification E-value
Superfamily HMG-box 1.57e-25
Family HMG-box 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000011397   Gene: ENSEEUG00000012491   Transcript: ENSEEUT00000012499
Sequence length 492
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_8572:12463:114545:-1 gene:ENSEEUG00000012491 transcript:ENSEEUT00000012499 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FDAENMYMSMTEPSQDYVPASQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMQDIRNPEGTQYSPHPQ
MTAMRPRGQPADIRQQPGMMQHGQLTTINQSQLSAQLGLNMGGSSVPHNSPSPPGSKSAT
PSPSSSVHEDEGDDTSKINGGEKRPASDMGKKPKTPKKKKKKDPNEPQKPVSAYALFFRD
TQAAIKGQNPNATFGEVSKIVASMWDGLGEEQKQVYKKKTEAAKKEYLKQLAAYRASLVS
KSYSEPVDVKTSQPPQLINSKPTVFHGPSQTHSALYLSSHYHQQPGMNPHLTAMHPSLPR
SIDTKPSNQMAVTVSIGNMAVSPPPPLQISPPLHQHLNMQQHQPLSMQQPLGSQLPMQVQ
SALHSPTMQQGFTLQPDYQTIINPTSTAAQVVTQAMEYVRSGCRNPPAQPVDWNNDYCSS
GVMQRDKALYLT
Download sequence
Identical sequences ENSEEUP00000011397 ENSEEUP00000011397

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]