SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000011448 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000011448
Domain Number 1 Region: 2569-2673
Classification Level Classification E-value
Superfamily Bromodomain 6.02e-37
Family Bromodomain 0.0000445
Further Details:      
 
Domain Number 2 Region: 182-238
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000000166
Family PHD domain 0.0021
Further Details:      
 
Domain Number 3 Region: 2522-2560
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000332
Family PHD domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000011448   Gene: ENSEEUG00000012433   Transcript: ENSEEUT00000012560
Sequence length 2688
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_7016:4591:146867:1 gene:ENSEEUG00000012433 transcript:ENSEEUT00000012560 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RRKARVHRPRSPILEEKDIPPIEFPKSSEDLMVPSEHVMNVIAIYEVLLNFGSVLRLSPF
RFEDFCAALVSQEQCTLMAEMHVVLLKAVLREEDTSNTTFGPADLKDSVNSTLYFIDGMT
WPEVLRVYCESDKEYHHVLPFQEAEDYPYGPVENKIKVLQFLVDQFLTTNIAREELMSEG
VIQYDDHCRVCHKLGDLLCCETCSAVYHLECVKPPLEEVPEDEWQCEVCVAHKVPGVTDC
VAEIQKNKPYIRHEPIGYDRSRRKYWFLNRRLIIEEDTENEDEKKIWYYSTRVQLAELID
CLDKDYWEAELCKILEEMREELHRHMDITEDLTNKARGSNKSFLAAANEEILESIRAKKG
DIDIVKSPEEPEKDKTEPENNSKDAEETLEEFADRAPEKDNEDKTPDDDSQQRRSEAGDF
KIESNGEVSESPGAGRGASGSTRGIARLRNPDSKLSQLKSQQVAAAAHEANKLFKEGEVL
VVNSQGEVSRLSTKKDVVMKGNINNYFKLGQEGKYRVYHNQYSTNSFALNKHQHREDHDK
RRHLAHKFCLTPAGEFKWNGSVHGSKVLTISTLRLTITQLENNIPSSFLHPNWASHRANW
IKAVQMCSKPREFALALAILECAVKPVVMLPIWRESLGHTXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXVWKQKGEEYRVTGYGGWSWISKTHVSRFVPKLPGNT
NVNYRKSLEETKNSMDENMDESDKRKSPQSPKKIKIEPDSEKSEVKDSGTTKQTDQSETD
ISKVTEPDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXEENQRLEKIKLEGGIMGTVKTSTNSLKCLSESPDI
TKVKENCQSDLLRRDPGSDARQDNSEDLIQRCSPSDSSVLAASEPDQTATKLDCKDQVVE
DVIIQSPEADSKKQKSIGKDRDESLSEPPSKGQDVSEIKTKGSDFPVDDSKLASNDEIGI
LVYKNKKLPILEDSGTVASPSHSPLIPSEPKNASERVISSLSKAVDFEGKLECDSEYNST
LEDSSEEDMSVQNTSESISEQHTTQQPSLKSLGTLKREFVCANKSTGNCDGRPKGRITEA
NGKRSSQEQKLDVRPVNKCIDQIKLKNISDKKNSENQEPERKGQKTSSFQLNGKDKVHLK
GDCLKEVSESKVISDDVEPEVNNINNVTPKNEVECLSVQESAVRPFMNGDVIMEDFNGKN
SETTCLLRPSDVSDCQDSLESQPPPREPESTRTSTAPPCESSTENQVEDMKLPEVNDVTS
SAFVPEEQFNLSRHSLSETGPLSNKDDNDGESKRKTVITEVTTLTSTVATESKTVIKVAK
GDKQTVVSSTENCAKSTVTTTTTTVTKLSTPSTDNSVGIISVKEQSKTVVTTTVTDSLTT
SGGTLVTSMTVSKEYSTRDKVKLMKFSRPKKTRSGTALPSYRKFITKSSKKSIFVLPNDD
LKKLARKGGIREVPYFNYNAKPALDIWPYPSPRPTFGITWRYRLQTVKSLAGVSLMLRLL
WASLRWDDMAAKAPPGGGTTRTETSETEITTTEIIKRRDVGPYGIRSEYCIRKIICPIGV
PEAPKETPTPQRKGLRSSALRPKRPETPKQTGPVIIETWVAEEELELWEIRAFAERVEKE
KAQAVEQQNKKRLEQQKPIVTATSTTSSANSTTSTISPAQKVMVAPLSGSVTPGTKMVLT
TKVGSPATVTFQQNKNFHQTFATWVKQGQANSGVVQVQQKVLGIIPSSAGASQQTLTSFQ
PRTATVTIRPNTSGSSGTTSTSQVITGPQIRPGMTVIRTPLQQSPLGKTIIRTPVMVQPX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXGGNQGLTVVIQGQGQTTGQLQLIPQGVTVLPGPGQQLMQAAMPNGTVQ
RFLFTPLATTATTASTTTGTASTTAAGTGEQTQSKSSPPTQVPPASTLPPAPSSGVNPPE
AQPQTAQSPVHPQSQTQPKSPAHPEVQTQPEVQGQTTVASHTLSEAQPTQAQSSKPQVSV
QCQPQNNTQGQSPTRVQSPPQTRIHPSTPSQVSPGQQSQVQTSTSQPIPIQPHPSLQIPS
QGQPQSQPQVQSSAQTLSSGQTNQVTISAPSRQLQTQQPQPQINAVPQLQXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLQRVSHLRV
PHLKTQPQLEINREHTLQANQSEINQKQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXVEQKRIKQNVIKLFALLFKLKEQLKAEILRKRA
LLDKDLIEVQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXFYIGCDRCQNWYHGRCVGILQSEAELIDEYVCPQCQSTEDAMTVLTPLTEKDYEGLKR
VLRSLQAHKMAWPFLEPVDPNDAPDYYGVIKEPMDLATMEERVQRRYYEKLTEFVADMTK
IFDNCRYYNPSDSPFYQCAEVLESFFVQKLKGFKASRSHNNKLQSTAS
Download sequence
Identical sequences ENSEEUP00000011448 ENSEEUP00000011448

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]