SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000011601 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000011601
Domain Number 1 Region: 92-162
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.06e-18
Family PHD domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000011601   Gene: ENSEEUG00000012741   Transcript: ENSEEUT00000012732
Sequence length 436
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_850:285:3302:1 gene:ENSEEUG00000012741 transcript:ENSEEUT00000012732 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VVSEEKPLVLLRPQSTGSDPALGYVDLRALADGVCRYDLNDTDAAWLELTNEEXXXXXMP
ALNEHTMERVLEEFEQRCYDNMNRAIETEEGLGIEYDEDVVCDVCQSPEGEDGNEMVFCD
KCNICVHQACYGILKVPEGSWLCRTCALGVQPRCLLCPKKGGAMKPTRSGTKWVHVSCAL
WIPEVSIGSPEKMEPITKVSHIPSSRWALLCSLCNDKFGASIQXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVRNLTYMVTRREKIKRSVCKVQE
QIFSLYTKLLEQDRVP
Download sequence
Identical sequences ENSEEUP00000011601 ENSEEUP00000011601

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]