SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000011640 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000011640
Domain Number 1 Region: 19-217
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.16e-54
Family BCR-homology GTPase activation domain (BH-domain) 0.000062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000011640   Gene: ENSEEUG00000012740   Transcript: ENSEEUT00000012776
Sequence length 823
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_288:10208:102234:1 gene:ENSEEUG00000012740 transcript:ENSEEUT00000012776 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LMKNKGAKQKLKRKGASGAFGCDLTEYLENSGQDVPYVLKSCAEFIETHGIVDGIYRLSG
VTSNIQRLRQEFGSDQCPDLTREVYLQDIHCVGSLCKLYFRELPNPLLTYELYEKFTEAV
SHCPEESQLARIQNVIQELPPPHYRTLEYLIRHLAHIASFSCKTNMHARNLALVWAPNLL
RSKEIEASACNGDAAFLAVRVQQVVIEFILNHVDQIFNSSAPGSLENNENRPIMKSLTLP
ALSLPMKLVSLEEAQARSLATNHPACKERRENSLPEIVPPMGTLFHTVLELPDNKRKLSS
KSKKWKSIFNLGRSGSDSKSKLSRNGSVFVRGQRLSVEKATIRPAKSMDSLCSVPMEGKE
TKGNFNRTVTTGGFFIPAAKMLSSNMGSSCDLSKQESEWGQEVMPAGAEGGFDSSCQFQG
AQGRPPPEQLKVIRPIEDPESEQTPKMLGMFYTSNDNPSKSVFTSSLFHVEPSPRHQRKA
LNISEPFAVSVPLRVSAVISTNSTPCRTPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXSVPKKTTVDDAKPIPEAVRMVESNKDLSLEPDPQVEEKKTSETTTDSQHPSDLE
KRLTPEKVVEEKGEAGQEASVLQDSPRTHIKNMFLHEMDEDDLANALIWPEIQQELKIIE
SEEELSVLPPPAAEFNQAQPIEESGSGVFPSPSRPPPVSAPLEKWTSQSAQGAATYREEP
GSEPQKGLRPDPASLSPLQIADMASSQARMEAGDQGNLFPLLPPAPPPPTSLGEEPLVHQ
PVFPEVEDVSWKLRTTSYAEERNAKRCHEPGLCHGEESPHRQR
Download sequence
Identical sequences ENSEEUP00000011640 ENSEEUP00000011640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]