SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000011677 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000011677
Domain Number 1 Region: 345-380
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000345
Family PHD domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000011677   Gene: ENSEEUG00000012822   Transcript: ENSEEUT00000012819
Sequence length 380
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_696:8954:34043:1 gene:ENSEEUG00000012822 transcript:ENSEEUT00000012819 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLYLEDYLEMIEQLPMDLRDRFTEMREMDLQVQNAMDQLEQRVSEFFMNAKKNKPEWREE
QMASIKKXXXXXXXXXXXXXXXXXXXXXXVDRHLRKLDQELAKFKMELEADNAGITEILE
RRSLELDTPSQPVNNHHAHSHTPVEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXCRNNNSTTSSNNAYNVNSSQPLASYNIGSLSSGTGAGAITMAAAQAVQATAQMK
EGRRTSSLKASYEAFKNNDFQLGKEFSMPRETAGYSSSSALMTTLTQNASSSAADSRSGR
KSKNNNKSSSQQSSSSSSSSSLSSCSSSSTVVQEISQQATVVPESDSNSQVDWTYDPNEP
RYCICNQVSYGEMVGCDNQD
Download sequence
Identical sequences ENSEEUP00000011677 ENSEEUP00000011677

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]