SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000011726 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000011726
Domain Number 1 Region: 237-370
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 7.06e-33
Family BCR-homology GTPase activation domain (BH-domain) 0.00091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000011726   Gene: ENSEEUG00000012883   Transcript: ENSEEUT00000012873
Sequence length 569
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_5456:104:48995:1 gene:ENSEEUG00000012883 transcript:ENSEEUT00000012873 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTECFLPPTSSPSEHRRVEHGSGLTRTPSSEEISPTKFPGLYRTGEPSPPHDSLHEPPDL
VSDDEKDHGKKKGKFKKKEKRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIKSKV
DELKAAYDREESPNLEEYEPNTVASLLKQYLRDLPENLLTKELMPRFEEACGRNTETERV
QELQRLLKELPECNYLLISWLIVHMDHVIAKELETKMNIQNISIVLSPTVQISNRVLYVF
FTHVQELFGNVALKQVTRPLRWSNMATMPTLPELQEHIKEEIRRQEFLLNCLHRDLQGGI
KDLSKEERLWEVQRILTALKRKLREAKRQECETKIAQEIASLSKEDVSKEEMNENEEVIN
ILLSQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRQQHGRSETEEYSS
ESESESEDEDEDELQVILEDLQRQNEELE
Download sequence
Identical sequences ENSEEUP00000011726 ENSEEUP00000011726

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]