SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000011798 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000011798
Domain Number 1 Region: 65-241
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.71e-44
Family BCR-homology GTPase activation domain (BH-domain) 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000011798   Gene: ENSEEUG00000012964   Transcript: ENSEEUT00000012951
Sequence length 279
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_3122:615:18352:1 gene:ENSEEUG00000012964 transcript:ENSEEUT00000012951 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKKIPALALIELTALCDVLGLELKRNKAGKRRPTXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXLLTCLEKRGLDTEGILRVPGSQARVKGLEQKLEREFYSGLFSWEEVHHHDASDLL
KRFIRELPAPLLTAEYLPAFAVVPNIPDLKQRLQALHLLILILPEPNRNVLKALLEFLRK
VVAREKSNKMSLWNVSTVMAPNLFLHRGRPPKLSKGKEKQLAEGAAEVVQMMVQYQDLLW
TVASFLVAQVRKLNDSSTRRSQLCDGGLKTWLRRTHADR
Download sequence
Identical sequences ENSEEUP00000011798 ENSEEUP00000011798

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]