SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000011919 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000011919
Domain Number 1 Region: 18-150
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.08e-44
Family Type II thymidine kinase 0.0000008
Further Details:      
 
Domain Number 2 Region: 150-201
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000019
Family Type II thymidine kinase zinc finger 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000011919   Gene: ENSEEUG00000013073   Transcript: ENSEEUT00000013078
Sequence length 233
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_6648:38:12630:-1 gene:ENSEEUG00000013073 transcript:ENSEEUT00000013078 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSCINLPSVLPGSPSKTRGQIQVILGPMFSGKSTELMRRVRRFQIAQYKCLVIKYAKDTR
YSTNFSTHDRNTMEALPACQLRDVAQEALAVAVIGIDEGQFFPDIVEFSEAMANTGKTVI
VAALDGTFQRKAFGNILNLVPLAESVVKLTAVCMECFREAAYTKRLGVEKEVEVIGGADK
YHSVCRLCYFKKAAHADNMDNKENCPALVRPGEATGVRKLFAPHQIRQCSSAN
Download sequence
Identical sequences ENSEEUP00000011919 ENSEEUP00000011919

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]