SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000011987 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000011987
Domain Number 1 Region: 275-452
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 6.87e-51
Family BCR-homology GTPase activation domain (BH-domain) 0.00000131
Further Details:      
 
Domain Number 2 Region: 2-163
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 6.54e-40
Family BAR domain 0.0069
Further Details:      
 
Domain Number 3 Region: 135-244
Classification Level Classification E-value
Superfamily PH domain-like 9.92e-16
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 
Domain Number 4 Region: 594-649
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000021
Family SH3-domain 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000011987   Gene: ENSEEUG00000013124   Transcript: ENSEEUT00000013151
Sequence length 650
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_6418:11146:66720:1 gene:ENSEEUG00000013124 transcript:ENSEEUT00000013151 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DGKKKFDKESEKYYSILDKHLNLSAKKKESHLQEADTQIDREHQNFYEASLEYVFKIQEV
QEKKKFEFVEPLLSFLQGLFTFYHEGYELAQEFAPYKQQLQFNLQNTRNNFESTRQEVER
LMQRMKSASQDYRPPSQWTVEGYLYVQEKPPGPLGFTWIKHYCTYDKGSKTFTMSVSEVK
SSGKMNGLVTSSPEMFKLKSCIRRKTDSIDKRFCFDIEVVERHGIITLQAFSEANRKLWL
EAMDGKEPIYTLPAIISKKEESKSFLYLNEAGFNFVRKCIQAVETRGITILGLYRIGGVN
SKVQKLMTTTFSPKSPPDMDIDIELWDNKTITSGLKNYLRCLAEPLMTFKLHKDFIVAVK
SDDQNYRVEAVHALVHKLPEKNREMLDILIKHLVKVSLHSQQNLMTVSNLGVIFGPTLMR
AQEETVAAMMNIKFQNIVVEILIEHYEKIFHTAPDPSIPLPQPQSRSSSRRTRAICLSTG
PRKPRGRYTPCLAEPDSDSYSSSPDSTPMGSIESLSSHSSEQNSTSKSAPCPPREKSGGI
PWIASPSPSNGQKSLWTTSPESSSKETPKAPVNPDLPPKMCSRLRLDTASNGSFSQARAM
YSCKAEHSHELSFPQGAVFSNVYPSVEPGWLKATYEGKTGLVPENYVVFL
Download sequence
Identical sequences ENSEEUP00000011987 ENSEEUP00000011987

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]