SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000012507 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000012507
Domain Number 1 Region: 368-572
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.15e-54
Family DBL homology domain (DH-domain) 0.00039
Further Details:      
 
Domain Number 2 Region: 560-687
Classification Level Classification E-value
Superfamily PH domain-like 1.78e-20
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 
Domain Number 3 Region: 723-782
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.58e-19
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0034
Further Details:      
 
Domain Number 4 Region: 854-913
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000236
Family Pleckstrin-homology domain (PH domain) 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000012507   Gene: ENSEEUG00000013691   Transcript: ENSEEUT00000013720
Sequence length 954
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_1552:31593:74168:-1 gene:ENSEEUG00000013691 transcript:ENSEEUT00000013720 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHGHRAPGGAGPSEAELPASNPACAAPPAYADSNPGTLDPGLLLPRGSGSAFGAPPDSQF
AGPSDASSGTAPSPWAVPCVPSPQHHQTLRFYHLEGSQSRLGLHQGNRILVKSLSLDPGQ
NLEPHPEGPQRLRSDPGPPTESPIQRPSPLKRAPGPKPQVPPKPSYLQMSRLLAPPEPIP
PPPSRPLPADPRVAKGLTLRVDSSPSSAAVSSLIEKFEREPVIVASDRPVPGPSSGPTEP
AMLPQPPLQPPVSQLPEGEASRCLFLLAPGPRDGEKMPNRDSGIDSISSPSNSEETCFVS
DDGPPSHSLCLGPPALASAPVPLADPHRPGSQEVDSDLEEEDEDEEDEKDREIAVLPMER
HESVELTVQQKVFHIANELLQTEKAYVSRLHLLDQVFCARLLEEARNRSSFPADIVHGIF
SNICSIYCFHQQFLLPELEKRMEEWDRYPRIGDILQKLAPFLKMYGEYVKNFDRAVELVN
TWTERSTQFKVIIHEVQKEEACGNLTLQHHMLEPVQRIPRYELLLKDYLLKLPHGSPDSK
DAQKSLELIATAAEHSNAAIRKMDRMPSFLKVYDPLGEDICKPTKELIKEGHILKLSAEI
GTQDGLILFNDRLLYCVPRLRLLGQKFSVRARIDVDGMELKESSNLNLPRTFLVSGKQRS
LELQARTEEEKKDWVQAINSTLLKHEQTLETFKLLNSANREDEDTPPNSPNVDLGKRAPT
PIREKEVTMCMRCQEPFNSITKRRHHCKACGHVVCGKCSEFRARLIYDNNRSNRVCTDCY
VALHGVPGSSPACSQHTPQRRRSILEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXDVKAQRSLPLIGFEVGPLEAGERPDRRHVFKITQSHLSWYFSPETE
ELQRRWMAVLGRAGRGDTFCPGPTLSEDKEREEVSVATSGTTAEPHEAPQTDKT
Download sequence
Identical sequences ENSEEUP00000012507 ENSEEUP00000012507

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]