SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000012614 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000012614
Domain Number 1 Region: 337-397
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000000267
Family PHD domain 0.0076
Further Details:      
 
Domain Number 2 Region: 283-348
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000699
Family PHD domain 0.019
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000012614
Domain Number - Region: 98-177
Classification Level Classification E-value
Superfamily Major capsid protein VP5 0.0432
Family Major capsid protein VP5 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000012614   Gene: ENSEEUG00000013837   Transcript: ENSEEUT00000013835
Sequence length 410
Comment pep:novel scaffold:HEDGEHOG:scaffold_235270:296:17715:-1 gene:ENSEEUG00000013837 transcript:ENSEEUT00000013835 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLQEQVSEYLGVTSFKRKYPDLERRDLSHKEKLYLRELNVITETQCTLGLTALRSDEVID
LMIKEYPAKHAEYSVILQEKERQRITDHYKEYSQMQQQNTQKVEASKVPEYIKKAAKKAA
EFNSNLNRERMEERRAYFDLQTHVIQVPQGKYRVLPTERTKVSSYPVALIPGQFQEYYKR
YSPDELRYLPLNTALYEPPLDPELPALDSDGDSDDAEDGRGDEKRKSKGTSDSSSGNVSD
GEGLPDSQEESFQGRQRSKDRTATPRKDASKRSVLSKSVPGYKPKAIPNAICGICLKGKE
SNKKGKAEPLIHCSQCDNSGHPSCLDMSMELVSMIKTYPWQCMECKTCIICGQPHHEEEM
MFCDVCDRGYHTFCVGLGAIPSGRWICDCCQRAPPTPRKVGRRGKNSKEG
Download sequence
Identical sequences ENSEEUP00000012614 ENSEEUP00000012614

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]