SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000012826 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000012826
Domain Number 1 Region: 5-63
Classification Level Classification E-value
Superfamily HMG-box 0.00000000419
Family HMG-box 0.0039
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000012826
Domain Number - Region: 133-230
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.0759
Family DnaQ-like 3'-5' exonuclease 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000012826   Gene: ENSEEUG00000014050   Transcript: ENSEEUT00000014062
Sequence length 427
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_4595:10536:44681:1 gene:ENSEEUG00000014050 transcript:ENSEEUT00000014062 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPNRRASRNAYYFFVQEKIPELRRRGLPVARVADAIPYCSADWAFLSEEEKEKYAEMARE
WRAAQGKDAGPSEKQKPVSTPLRKPGMLVPKQNISPPDMSSLSLKSDQALLGGIFYFLNI
FSHGELPPHCEQRFLPCEIGCVKYSLQEGIMADFHSFINPGEIPRGFRFHCQAASDSSHK
IPISNFESGHDQTTVLKNLFRFIHPSPGNWPPIYCKSDDRARVNWCLKHMGKASXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCKWHEENDILFCALAVCK
KIAYCISNSLATLFGIQLTKAHVPLQDYEARNSVTPKMVVLDAGRYQKLRVENQGFCHFN
SSNQDHRSNTPTGDYPSGVKFSGQNSSVRGRGITRLLESISSSSSNIHRFSHCETHLSPY
MSQKDGY
Download sequence
Identical sequences ENSEEUP00000012826 ENSEEUP00000012826

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]