SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000013226 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSEEUP00000013226
Domain Number - Region: 1372-1413
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0468
Family PHD domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000013226   Gene: ENSEEUG00000014459   Transcript: ENSEEUT00000014496
Sequence length 1417
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_4688:15106:55389:-1 gene:ENSEEUG00000014459 transcript:ENSEEUT00000014496 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLEKYPNTPMSHKEILQVIQREGLKEISGTSPLACLNAMLHTNSRGEEGIFYRVPGRMGV
YTXXKDVPDGLKELSEGSEESSDGQSDSQSSENSSSSSDGGSNTEGKKSRWKRKXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXALKQQQQKKQQQQQQCRPGMSISSNNQHLSLK
TVKAASDSVSAKPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVGPD
GLMKLNGSALNNEFFTSAAQGWKERLSEGEFTPEMQVRIRQETEKEKKVEPWKEQFFESY
YGQSSGLSLEESKKLTASPSDPKVKKSPAEQPKSMLPSEASPVSIVPAIPPSESKEEVMQ
ILSLVRKEEPRSQEKIPSSPSTPPNPSLSPASHTKELSDIPCIQCPKAEGLSQQNQVXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXIPVSRLSPMLFPSSQVSPRARFPISITSPNRTGARTLADIKAKAQLVKAQRAAAAAA
AAAAAAASVGGTIPGPGPGGGQGPGDGGEGRSARAGSPPSDRIGETGKGPTLELAGTGSR
GGTRELLPCRPETQPQSETRIPGQAQPPSGPGAQLQQTPSVPPASATGRACTSAPSPAHL
GKADNESLNPPRAAARVAPLSLPQGPSSCRQEKAPSTPTDPALLSDASPAHFTAEGPVET
KAGCSQKISGLSVSAETSATAPMDMDPSPFTSPSPTATLAKLAVPQVSVTTAPTTSALPS
NTLPAASSLKTPVMSSDLNGPISRPSSSIPANNPLVTQLLQGKDVPMEQILPKPLTKVEM
KTVSLSIKEEKGGTGTNMTDNSSSADVHERQFHPAAQPLSKMSQSRQLPPVPRPFPRFSG
KDLRDAPIDTHQYQEGLSKASQDQILQALMQRVQMPSVFSFLQPPQFNFTHSGFQVEDVS
MSHRFMLGFTGRRTSRPAMAGHYLLNISTYGRGSESVRRTHSVNSDDRLCLSSPHEASKT
GYPECRNAADDSSNRDEDSGEESAGDEQESVLVKEEPQAPQAAGRCEAGSGPRSGEPLSS
AECLVKKSVKAESPMREQSILSRESCSFTRGQMLDDKTLARDFIQAAQKQMAHAVRGKAM
CGSPELFTSTALPLPADSPTHQPVLLPPLQTPKLYASPTQMGPSYRGTINVSTSCNMDHK
VRWSGECLDSSPVANVGDVMSISVSVTTIPASQAMKSSSHGQSIPVQAFREENSIEDAPS
KCYCRLKAMIMCKGCGAFCHDDCIGPSKLCVSCLVVR
Download sequence
Identical sequences ENSEEUP00000013226 ENSEEUP00000013226

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]