SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000013444 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000013444
Domain Number 1 Region: 154-216
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000000664
Family PHD domain 0.005
Further Details:      
 
Domain Number 2 Region: 704-763
Classification Level Classification E-value
Superfamily SMAD/FHA domain 0.0000000478
Family FHA domain 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000013444   Gene: ENSEEUG00000014729   Transcript: ENSEEUT00000014734
Sequence length 896
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_6604:56001:87627:-1 gene:ENSEEUG00000014729 transcript:ENSEEUT00000014734 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXEEPVVADPDYVQPQLKRPFELLIAAAMERNPTQF
HLPNELTCTTALPGSSKRRRKEETTGKNVKKTQHELDHNGLVPLPVKVCFTCNRSCRVAP
LIQCDYCPLLFHMDCLEPPLTAMPLGRWMCPNHIEHVVLNQKNMLSNRCQVFDRFQDTIS
QHVVKVDSLNRIHKKHPPNRRVLQSVKRRSLKVPDAIKSQYQFPPPLIAPAAIRDGELIC
NGIPEESQTHLLNSEHLATQAEQQEWLCSVVALQCSILKHLSAKQMPSHWDSEQTEKADI
KPVIMTDSSLTTSLQTADKAPTPSHYPLSCPSGISTQNSLSCSPPHQSPALEDINCSSCV
EKSKKIPCGTVNGPVNTEVKVNGPHLYSSPTDSMDPRRLPGASTPLPSLSHRQGWPRPLT
PPAAGGLQNHTVGIIVKTENATGPSSCPQRSLVPVPSLPPSTPSSCASIENTSTLQRQTV
QPQMGPPLTDPRPLGSPPSATRVLTPPQAAGDGILATSQRFCSPAPSSDGKVSPGTLSIG
SALTVPSFPANSTAMVDLTNSLRAFMDVNGEIEINMLDEKLIKFLALQRIHQLFPSRVQA
SPGNIGAHPLASGVHHIEVQRKEVQARAVFYPLLGLGGAVNMCYRTLYIGTGADMDVCLT
NYGHCNYVSGKHACIFYDENTKHYELLNYSEHGTTVDNVLYSCDFSEKTPPTPPSSIVAK
VQSVIRRRRHQKQDEEPSEEAAMMSSQAQGPQRRPCNCKASSSSLIGGSGAGWEGTALLH
HGSYIKLGCLQFVFSITEFATKQPKGDAGLLQDGVLAEKLSLKPHQGPVLRSNSVP
Download sequence
Identical sequences ENSEEUP00000013444 ENSEEUP00000013444

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]