SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000013607 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000013607
Domain Number 1 Region: 915-1020,1220-1307
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.9e-22
Family p120GAP domain-like 0.029
Further Details:      
 
Domain Number 2 Region: 4-104
Classification Level Classification E-value
Superfamily Sema domain 1.44e-21
Family Sema domain 0.0075
Further Details:      
 
Domain Number 3 Region: 445-539
Classification Level Classification E-value
Superfamily E set domains 4.33e-16
Family Other IPT/TIG domains 0.0047
Further Details:      
 
Domain Number 4 Region: 537-599
Classification Level Classification E-value
Superfamily E set domains 0.00000000000267
Family Other IPT/TIG domains 0.032
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000013607
Domain Number - Region: 408-442
Classification Level Classification E-value
Superfamily Plexin repeat 0.0785
Family Plexin repeat 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000013607   Gene: ENSEEUG00000014853   Transcript: ENSEEUT00000014908
Sequence length 1309
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_8297:5:16912:-1 gene:ENSEEUG00000014853 transcript:ENSEEUT00000014908 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GASESFPCGSEHLPYPLGSRDGLTATAVLQRGGLNLTAVTVAAENNHTIAFLGTSDGRVL
KVYLTQNGSSSEYGSILVEINKKIKQDLVLSADGNSLYAMTQDKXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXCTRRAQCPRAEESGHWLWSRDESCVTITGAQPQNMSRRAQGE
VLLTISPLPALNEDDELLCHFGDSPSHSARVEGNAIICNSPSSIPGTPPGQXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVSSLHVGSDLLKFEEQVTMR
ETGTFSFQTPKLSHDANETLPLHLYVKSFGKNIDSKLQVTLYNCSFGRSDCSLCLAADPA
YKCVWCGSQTGCVYEALCSNTTSECPPPVITRIQPETGPLGGDIRLTILGSNLGVRAEDV
KSVTVAGQNCVFKPEQYSVSTRIVCVIEAAETSLTGGIEVDVNGKLGHSPPHVQFTYQEP
QPTSVEPKQGPLAGGTVLTINGIHLDTGSEEDVRVTIAGVPCNVTQFGEQLQCVTGAXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXGREVVWARCKKEFTYLMIEMKQTRDVHEAGIPVLDYKTYTDRVFFLPSKDGDKDVMIT
GKLDIPESRRPTMEQALYQFSNLLNSKSFLINFIHTLENQREFSARAKVYFASLLTVALH
GKLEYYTDIMRTLFLELMEQYVVAKNPKLMLRRSETVVERMLSNWMSICLYQYLKXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXWPKADSVVLEWRPGSTAQILSDLDLTSQREGRW
KRINTLMHYNVRDGATLILSKVGVSQQPEDSQQDLPGERHALLEEENRVWHLVRPTDEVD
EGKSKRGSVKEKERTKAITEIYLTRLLSVKGTLQQFVDNFFQSVLAPGHSVPPAVKYFFD
FLDEQAEKHDIKDEDTIHIWKTNSLPLRFWVNILKNTHFIFDVHVHEVV
Download sequence
Identical sequences ENSEEUP00000013607 ENSEEUP00000013607

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]