SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000013841 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000013841
Domain Number 1 Region: 730-842
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.94e-27
Family BCR-homology GTPase activation domain (BH-domain) 0.00042
Further Details:      
 
Domain Number 2 Region: 597-716
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000000000322
Family PLC-like (P variant) 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000013841   Gene: ENSEEUG00000015170   Transcript: ENSEEUT00000015167
Sequence length 1112
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_1272:11073:50300:-1 gene:ENSEEUG00000015170 transcript:ENSEEUT00000015167 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VRLCSSRSLESLQVGATPPRVQRWPSDSWLRCGPRGARDEPPPRGGGMHGWSRGSAGAPA
PSGLRTPGSRDRGCSSENPFGDPAGSSVIRCGSGDSQDGLPFFKPPAVTVKKLQKWMYKG
RLLSLGMKGRARGTPPKVTGVQTTPPNLGPLKMHESQFLPVPPDQRITLTDLFENVYGSS
MKRRELEDLKDNVEFRSYKPLNSITVSKKRNWLYQSTLRSFNLEEKNKKCQDRSHLSTIP
VSLPKHQLSRPLVRSSEEYCAYVVCNAANSSLSRKCSLDXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPGILAAPNRNELGITEP
SSPSPSPVKKGSSIGWSFPDKIKSPRTVRKLSMKMKRLPELSRKLSVKGTLNYVNSPDNT
SLPKYHCREIHHTVALPSGTTTTAAKRNVISRYHLDTSVSSQQSYQQKMSVHSKFSCKGG
YLSDGDSPELITKSGKHGSENKFGKGKEIIPNSGSKNEIDIDAFRHYSFSDQPKCSQYLS
GLMSVHFYGAEDLKPPRIDSKDVFCAIQVDSVNKARTALLTCRTTFLDMDHTFNIEIENA
QHLKLVVFSWEPTPRKNRVCCHGTVVLPTLFRVTKTHQLAVKLEPRGLIYVKVTLLEQCE
NSLHGLDMNREPVIFGVDIRKVVEKESTGLLVPLLIQKCVMEIEKRGCQVVGLYRLCGSA
AVKKELREAFERDSKAVGLCESQYPDINVITGVLKDYLRELPSPLITKQLYEAVLEAMVR
SPLKMSLNGCENDPSDSMYTVGLLDCLPDVEKXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQRFTVKASPD
NLFPEQKSSLNYLRRKKERPYVLNLSETDSSRVLRPRQTRLDSPLSNRYAGDWSSCGESY
FLNTKENLNDGDYDDVPSEARDDCGKLYESSMMIEQPLAMSKECTFQTYLTMQTIESTAD
RKVNLKDLQESIDTLIGNLERELNKNKLSMSV
Download sequence
Identical sequences ENSEEUP00000013841 ENSEEUP00000013841

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]