SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000013895 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000013895
Domain Number 1 Region: 74-153
Classification Level Classification E-value
Superfamily HMG-box 3.4e-21
Family HMG-box 0.00023
Further Details:      
 
Domain Number 2 Region: 2-64
Classification Level Classification E-value
Superfamily HMG-box 0.000000000000943
Family HMG-box 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000013895   Gene: ENSEEUG00000015230   Transcript: ENSEEUT00000015222
Sequence length 153
Comment pep:novel scaffold:HEDGEHOG:scaffold_367063:38614:39075:-1 gene:ENSEEUG00000015230 transcript:ENSEEUT00000015222 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EAPKPRISTFAFFLRMCKAEHQEKKPGARMNLVEFSRKCCRRWRMLSEEEKNAFRDLARA
ERERSDPQTRGHGPAGRRERDANAPKRRLSASFLFSSDFRPKVKADYPDITSGNMSKKLG
EMWSNLSNMEKRLYEDRVAQLRMQYNMVVAEYK
Download sequence
Identical sequences ENSEEUP00000013895 ENSEEUP00000013895

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]