SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000014089 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000014089
Domain Number 1 Region: 240-364
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 6.21e-19
Family Reprolysin-like 0.0032
Further Details:      
 
Domain Number 2 Region: 961-1014
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000667
Family TSP-1 type 1 repeat 0.0038
Further Details:      
 
Domain Number 3 Region: 915-962
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000759
Family TSP-1 type 1 repeat 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000014089   Gene: ENSEEUG00000015421   Transcript: ENSEEUT00000015436
Sequence length 1063
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_4542:530:26538:-1 gene:ENSEEUG00000015421 transcript:ENSEEUT00000015436 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ELLSSLESYEIAFPARVDHNGTLLAFSSAPPRQRRLRAGAEEEARLFYRVAAPSTHFLLN
LTRSPRLLAGQVSVEYWTRAGLAWQRVTRPHCLYAGHLQGQPRSSHVAISTCGGLHGLIV
AGEEEYLIEPLQGGPKGARGPKESGPHVVYKRSSLRYPHLDTACGVRDEKPWKGRPWRLP
QLKPPPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
VARLFQDSSLGNTVNILVTRLILLTEDQPTLEITHHAGKSLDSFCKWQKAIVSHGNAIPE
NGVANHDTAVLITRXXXXXXXXXXXXXXXLAPVGGMCERERSCSVNEDIGLATAFTIAHE
IGHTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXDCPPGSQDFREMQCSEFDSIPFRGKFYTWKTYRG
GGVKACSLTCLAEGFNFYTERAAAVVDGTPCRPDTVDICVSGECKHVGCDRVLGSDLREG
KCECGGRACETTDGVSSALPXXXXXXXXXXXXXXXXXXXXXXXXXXXLKGDQESLLLEGL
PGTPQPHRLPLAGTTFQLRQGPDHSQSLEALGPLNSSLVVMXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXCTPSCGPGLRHRVVLCKSADHRATLPAAHCSPAAKPPATMRCNLR
RCPPARWVAGEWGECSAQCGAGQQQRSVRCTGHAGQPSRECAEALRPPATQHCEARCDSA
PPGDGPEECKDVNKVAYCPLVFKFQFCSRAYFRQMCCKTCQGR
Download sequence
Identical sequences ENSEEUP00000014089 ENSEEUP00000014089

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]