SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000014183 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000014183
Domain Number 1 Region: 3-99,137-262
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.1e-46
Family FCH domain 0.0099
Further Details:      
 
Domain Number 2 Region: 433-596
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.04e-44
Family BCR-homology GTPase activation domain (BH-domain) 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000014183   Gene: ENSEEUG00000015533   Transcript: ENSEEUT00000015541
Sequence length 613
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_6023:11596:154483:1 gene:ENSEEUG00000015533 transcript:ENSEEUT00000015541 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RKDQNVLSPVNCWNLLLNQVKRESRDHTTLSDIYLNNIIPRFVQVSEDSGRLFKKSKEVG
QQLQDDLMKVLXXXXXVMKTYHMYNADSISAQSKLKEAEKQEEKQIGKSVKQEDRQTPRS
PDSTAIVRIEEKHVRRSSVKKIEKMKEKRQAKYTENKLKAIKARNEYLLALEATNASVFK
YYIHDLSDLIDQCCDLGYHASLNRALRTFLSAELNLEQSKHEGLDAIENAVENLDATSDK
QRLMEMYNSVFCPPMKFEFQPHMGDMASQLCTQQPVQSELVQRCQQLQSRLSTLKIENEE
VKKTMEATLQTIQDIVTVEDFDVSDCFQYSNSMESVKSTVSETFMSKPSIAKRRANQQET
EQFYFTKMKEYLEGRNLITKLQAKHDLLQKTLGESQRTDCSLAXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXLQHEGIFRVSGSQVEVNDIKNAFERGEDPLAGDQNDHDMDSIAGVLK
LYFRGLEQPLFPKDIFHDLMACVTMDNLQERALHIRKILLALPKTTLIIMRYLFAFLNHL
SQFSEENMMDPYNLAICFGPSLMSVPEGHDQVSCQAHVNELIKTIIIQHENIFPNPRELE
GPVYSRGGSMEDY
Download sequence
Identical sequences ENSEEUP00000014183 ENSEEUP00000014183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]