SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000014233 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000014233
Domain Number 1 Region: 49-397
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.47e-83
Family p120GAP domain-like 0.0000251
Further Details:      
 
Domain Number 2 Region: 353-495
Classification Level Classification E-value
Superfamily PH domain-like 1.73e-31
Family Pleckstrin-homology domain (PH domain) 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000014233   Gene: ENSEEUG00000015588   Transcript: ENSEEUT00000015593
Sequence length 591
Comment pep:novel scaffold:HEDGEHOG:scaffold_273091:8691:18679:-1 gene:ENSEEUG00000015588 transcript:ENSEEUT00000015593 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VEFPPQLLQQNPPDGWFRLLPFPKAEEDSGGSLGALRLKVRLTEDRVLPSRHYQPLTQLL
MESVQQRPAEEDTTSPLALLEELTLGDCRQDLATKLVKLFLGQGLAGPFLDYLTRREVAR
TTDPNTLFRSNSLASKSVEQFMKLVGMPYLHEVLKPVISRIFEERKYMELDPSKIDLGRT
RRISFKGSMSEEHVREASLGLLTGYLGPIVDAIVGSADHCPPAMRLAFQQLRRRVEERFP
QAEHQDVKYLAISGFLFLRFFAPAILTPKLFHLREHHADPQTSRSLLLLAKAVQSIGNLG
QQLGQGKELWMAPLHPFLLQSISRVRDFLDQLVDVSEAEAGCLARALVPPSVTVREGYLL
KRKEEPAGLATRFAFKKRYFWLSGETLSYSKGPECQIRHSLPVAHIRAVERVDEGAFQLP
HVMQVVTRAGAGGALHTTYLQCKNVNELNHWLSALRKASAPNPDKLAACHPGAFRARWTC
CLHPERSAPGCSRTHSAVTLGDWSDPLDPDAEVQTVYRQLLLGRDQIRMKFLEDLSPDAA
QEADPGASPTASSGQREAAARLLEVLEALDRAHEEFQQQEEGEEAPGPLRP
Download sequence
Identical sequences ENSEEUP00000014233 ENSEEUP00000014233

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]