SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000014389 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000014389
Domain Number 1 Region: 2-122
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.35e-29
Family BCR-homology GTPase activation domain (BH-domain) 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000014389   Gene: ENSEEUG00000015751   Transcript: ENSEEUT00000015763
Sequence length 842
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_4268:5933:279670:-1 gene:ENSEEUG00000015751 transcript:ENSEEUT00000015763 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGQEGLFRVSGSMKAVQRLRWTLERGATLEPGGDGEVSAAASLLKLFLRELPERLVPATL
QPRLLQLLWGDSSGAQESSLRDLLRELPDAHYQLLKYLCQFLTQVAQRHGQNRMDIHNLA
TVPNCFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEA
SHMKSLPMFLTKDIKRDIQKPSPKTKIPKSRSEGSIQIHRMPQPVLSESIPWLGFHPGRR
KPRSDKRSAEAAAGGRLVSSAPEDERPMSPFYLSAHVSQVGGVSTTEEGLINKENIPSGF
NSLDDCILNAQEVERLHETSGYIGETEKPTRQKSGSKLSELSDSQERLVNVGTLASVPSQ
ESPGPDDVELMSDKSKEANSSGDHTQHSENPAMKIQEHPGIADAKLQKTPEAAEPPEGCA
PPEAPPLELSALCADSGWEDPSPACSSWQQEQVDPAEAPRADLLIRQLRDEDSDPMLSPR
FYAYGQSRQYLDDTEVPPSPPNSHSFMRRRSSSLGSYDDEQEDLTPAQLTRRIQSLKKKI
RKFEDRFEEERKYRPSHSDKAANPEVLKWTNDLAKFRKQLKESKLKISEEDVTPMMRQRS
NTLPKSFGSQLEKEEEKKQELVDKALGPSVEATLESIQRKLQEKRTEASRPEDIKDMTKD
QIANEKVALQKALLYYESIHGRPVTKNERQVMKPLYDRYRLVKQILSRANAIPIIGSPST
KRRSPLLQPIIEGETASFFKEIKEEDQGSEDDSSTKPDLTVTLKTDFTARCFLDQFEDDT
DGFISPMDDKMPSKGSQDTGLSNLHAASIPELLEHLQEMREEKKRIRKKLRDFEDSFFRQ
HG
Download sequence
Identical sequences ENSEEUP00000014389 ENSEEUP00000014389

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]