SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000014563 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000014563
Domain Number 1 Region: 1121-1297
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.49e-41
Family BCR-homology GTPase activation domain (BH-domain) 0.00069
Further Details:      
 
Domain Number 2 Region: 683-798
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.44e-35
Family Pyk2-associated protein beta ARF-GAP domain 0.0014
Further Details:      
 
Domain Number 3 Region: 451-570
Classification Level Classification E-value
Superfamily PH domain-like 1.68e-26
Family Pleckstrin-homology domain (PH domain) 0.0000158
Further Details:      
 
Domain Number 4 Region: 1430-1566
Classification Level Classification E-value
Superfamily PH domain-like 7.08e-21
Family Pleckstrin-homology domain (PH domain) 0.023
Further Details:      
 
Domain Number 5 Region: 7-75
Classification Level Classification E-value
Superfamily SAM/Pointed domain 2.36e-16
Family SAM (sterile alpha motif) domain 0.0000678
Further Details:      
 
Domain Number 6 Region: 584-676
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000453
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 
Domain Number 7 Region: 1014-1107
Classification Level Classification E-value
Superfamily PH domain-like 0.000000115
Family Pleckstrin-homology domain (PH domain) 0.0084
Further Details:      
 
Domain Number 8 Region: 966-1037
Classification Level Classification E-value
Superfamily PH domain-like 0.00000284
Family Pleckstrin-homology domain (PH domain) 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000014563   Gene: ENSEEUG00000015937   Transcript: ENSEEUT00000015949
Sequence length 1699
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_371:81475:297202:-1 gene:ENSEEUG00000015937 transcript:ENSEEUT00000015949 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSASEVNLDIKDFLMSINLDQYVLHFRDFGFNTVKDCVTINDSVLHQIGISPTGHRRRI
LKQLQIILSKMQDIPIYANVHKMKSDKTLKDPRILSSDQNTCLQLLDSSGIQTPSPVHSD
SVTESLDPGDISGENSPSLKSDDKFFPTHNFPVPEEPHLSLGSCQDSSLDSKNIKVESLT
TEKNVNCTTEEQRGNIDFISENTSQDSSADPHCFSSFGCPKSEGNSGSGTNGLLESTSTP
PFFQFQGEMVVNDLYVPSSPILTPMRSRSKLVSRPSRSFLLRHRPVPEIPGSTKGTSGSY
FRERRNGATSAGKPVTQQXXXXXXXXXXXXXXXXXXXXXXXXXXKRCIKNEFWTHDEPLK
GEATTERNSFIVKSSIYDNRQESISEDKVEDIWIPREDKNNIPVESTSESEYSTVEECFQ
SLRRKNSKSSKSRTQKSLNVDPVNRHTYPLSSTSGNADSSVISSNAISPYACFYGSSARK
VKSGWLDKLSPQGKRMFQKRWVKFDGLSVSYYNNEKEKYSKGIIPLSAISSVRVQGDNKF
EVITTQRTFVFRAEKEEERNDWISILLNALKSQSLSSQSQAALVPDKCGNLELRGYKAKI
YTVLSGNSVWLCKNEQDFKSGLGITIIPMNVANVKQVDRSAKQSFEIITPYRSFSFTAES
EKEKQEWIEAVQQSIAETLSDYEVAEKIWFNESNRSCADCKAPDPDWASINLCVVICKKC
AGQHRSLGPKDSKVRSLKMDASIWSNELIELFIVIGNKRANDFWAGNLKKDEELHMDSPV
EKRKKFITQKYKEGRFRKTLLASLTKEELNKALCAAVVKPDVLETMALLFSGADVMCATG
DPMHSTPYLLAKKAGQSLQMEFLYHNKFSDFPQHDIHCEGGLNQESPQSTFLCDFLYQSP
SAAPKLSSEKKVLEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXPIFTFEIYLPSERAFLFGAETSQTQRKWTEAIVKHFVPFVAENLTEADYNLIGQLYY
KDCHALDQWRKGWFAMHKSSLHFCLQMQEVQEDRMHLRRLQELTISTMVQNGEKVDVLLL
VEKGRTLYIHGHTKLDFTVWHTAIEKAAGTDGDALRDQQLSKNDVPIIVNSCIAFVTQYG
LGCKYIYQKTGDPLHINELLESFKKDARSFKLRAGKHQLDDVTSVLKKFLNDIDDALLTK
ELYPYWISALDTQDDKERMKKYSAFIRTLPGVNRATLAAVIEHLYRVQKCSEINHMNAHN
LALVFSSCLFQTKGQTSEEVNVIEDLINNYVEIFEVKEDQVKQMDIENSFITKWKDTQVS
QAGDLLIEVYVERKEPDCSIIIRISPVMEAEELTNDILAIKNIIPSKDDIWATFEVIENE
ELERPLHYTENVLEQVLRWSSLSEPGSAYLVVKRFLTIDTIRRHNERRAQESIKEGVLKI
KEEPSKILSGNKFQDRYFVLRDGCLFLYKDQKSTKHDKMFSLNSMKFFLGVKKKMKPPTS
WGLTAYFEKHHWHLCCDSLQTQTEWMASIFIAQHENDIWPPAGKERKRSITKNPKIGGLP
LIPIQQERNASQARRNLESTRAELDRLRLSDKHCPEYEDQTLKEKASLVAHCLEHKDDKL
RNRARKHRSFNCLEDTEAEVFYSRHKGLKTLKKTEDKSNRTTLDSDNKLPSNVIEELSAV
LQRSRILSKELQGEKILQK
Download sequence
Identical sequences ENSEEUP00000014563 ENSEEUP00000014563

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]