SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000000627 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000000627
Domain Number 1 Region: 1055-1223
Classification Level Classification E-value
Superfamily RUN domain-like 1.96e-25
Family RUN domain 0.014
Further Details:      
 
Domain Number 2 Region: 822-894
Classification Level Classification E-value
Superfamily RUN domain-like 0.000000000000536
Family RUN domain 0.0029
Further Details:      
 
Domain Number 3 Region: 951-1000
Classification Level Classification E-value
Superfamily Lipase/lipooxygenase domain (PLAT/LH2 domain) 0.00000000000308
Family Lipoxigenase N-terminal domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000000627   Gene: ENSEEUG00000000709   Transcript: ENSEEUT00000000709
Sequence length 1225
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_7827:8221:89132:-1 gene:ENSEEUG00000000709 transcript:ENSEEUT00000000709 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LCQYIQASKARDGASPFISSTTEGENFEQTPLRRTFKSKVLARYPENVEWNPFDQDAVGM
LCMPKGLAFKTQADTREPQFHAFIITREDGSRTFGFALTFFEEVTSKQICSAMQTLYHMH
NAEYDVLHAPTADGQDHCSMEDGEGTPGTKLQRFNSYDISRDTLYVSKCICLITPMSFMK
ACRSVLEQLHQAVTSPQPPPLPLESYIYNVLYEVPLPPPGRSLKFSGVYGPVICQRPSTN
ELPLFDFPVKEVFELLGVENVFQLFTCALLEFQILLYSQHYQRLMTVAETITALMFPFQW
QHVYVPILPASLLHFLDAPVPYLMGLHSNGLDDRSKLELPQEANLCFVDIDNHFIELPED
LPQFPNKLEFVQEVSEILMAFGIPPEGNLHCSESASKLKRLRASELVSDKRNGNIAGSPL
HSYELLKENETIARLQALVKRTGVSLEKLEMREDPSTNKDLKVQCDEEELRIYQLNIQIR
EVFANRFTQMFADYEVFVIQPSQDKESWFTNREQMQNFDKASFLSDQPEPYLPFLSRFLE
TQMFASFIDNKIMCHDDDDKEPVLRVFDSRVDKIRLLNVRTPTLRTSMYQKCTTVDEAEK
AIELRLAKIDHTAVHPHLLDMKIGQGKYEPGFFPKLQFDVLSTGPASNXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXKYIQEARSMGSTIRQPKLSNLSPSVIAQTNWKFVEGLLKE
CRNKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXILLDSERRKSDASSVKSPLRVSLIQDMRHIQNIGEI
KTDVGKARAWVRLSMEKKLLSRHLKQLLSDHELTKEQFLYHLLSFNARDYFCFTSVFTTI
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCQNLGKLTTVQ
IGHDNSGLYAKWLVEYVMVRNEITGHTYKFPCGRWLGKGMDDGSLERVLVGELLTSQPEA
DERPCRTPPLQQSPSVIRRLVTISPNNKPKLNTGQIQESIGEAVNGIVKHFHKPEKERGS
LTLLLCGECGLVSALEQAFQHGFKSPRLFKNVFIWDFLEKAQTYYETLEQNEVVPEENWH
TRARNFCRFVTAINNTPRNIGKDGKFQMLVCLGARDHLLHHWIALLADCPITAHMYEDVA
LIKDHTLVNSLIRVLQTLQEFNITL
Download sequence
Identical sequences ENSEEUP00000000627 ENSEEUP00000000627

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]