SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000001259 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000001259
Domain Number 1 Region: 2-95
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.77e-23
Family Lectin leg-like 0.00000459
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000001259
Domain Number - Region: 122-159
Classification Level Classification E-value
Superfamily HMG-box 0.00628
Family HMG-box 0.0041
Further Details:      
 
Domain Number - Region: 182-248
Classification Level Classification E-value
Superfamily MxiH-like 0.034
Family MxiH-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000001259   Gene: ENSEEUG00000001401   Transcript: ENSEEUT00000001397
Sequence length 350
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_771:3112:25833:-1 gene:ENSEEUG00000001401 transcript:ENSEEUT00000001397 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KNNPAVVIVGNNGQIQYDHQNDGASQALASCQRDFRNKPYPVRAKVVYYQKTLTIMINNG
FTPDKNDYEFCAKVENMVIPAQGHFGISAATGGLAXXXXXXXXXXXXXXXXXXXXPTPDI
EISEQEKEKYQEEFEHFQQELDKKKEEFQKGHPDLQGHPAEEMFETVGDRELRQVFEGQN
RIHLEIKQLNRQLDMILDEQRRYVSSLTEEISRRGPGAMGHGQITQQELNTIVNTQNEIL
RQVNEMKNSMSETVRLVSGIQHPGPAGSVYEATQHFNDIKEHLHVVKRDIDHLVQRNVPS
NDRPKCPELPPFPSCLSTMHFVIFVVAQTVLFIGYIMYRTQQEAAAKKFF
Download sequence
Identical sequences ENSEEUP00000001259 ENSEEUP00000001259

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]