SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000001953 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000001953
Domain Number 1 Region: 422-678
Classification Level Classification E-value
Superfamily YWTD domain 7.98e-61
Family YWTD domain 0.000000905
Further Details:      
 
Domain Number 2 Region: 1336-1588
Classification Level Classification E-value
Superfamily YWTD domain 3.66e-56
Family YWTD domain 0.00000311
Further Details:      
 
Domain Number 3 Region: 735-818,918-1024
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 0.00000000000183
Family SGL-like 0.027
Further Details:      
 
Domain Number 4 Region: 249-285
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000055
Family LDL receptor-like module 0.00065
Further Details:      
 
Domain Number 5 Region: 1290-1335
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000144
Family EGF-type module 0.0082
Further Details:      
 
Domain Number 6 Region: 48-83
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000929
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 7 Region: 377-415
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000116
Family EGF-type module 0.0061
Further Details:      
 
Domain Number 8 Region: 8-49
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000017
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 9 Region: 683-734
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000519
Family EGF-type module 0.01
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000001953
Domain Number - Region: 1031-1100
Classification Level Classification E-value
Superfamily YWTD domain 0.000863
Family YWTD domain 0.0033
Further Details:      
 
Domain Number - Region: 1591-1629
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00444
Family EGF-type module 0.014
Further Details:      
 
Domain Number - Region: 1245-1284
Classification Level Classification E-value
Superfamily YWTD domain 0.0106
Family YWTD domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000001953   Gene: ENSEEUG00000002118   Transcript: ENSEEUT00000002144
Sequence length 1886
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_3809:11465:138694:-1 gene:ENSEEUG00000002118 transcript:ENSEEUT00000002144 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSSSPECACGRSHFTCAVSALGECTCIPAQWQCDGDNDCGDHSDEDGCMLPTCSPLDFHC
DNGKCIRRSWVCDGDNDCEDSDKQDCXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXSSMCAAEQFRCRSGRCVRLSWRCDGEDDCADNSDEENCENTXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXVNECAEEGYCSQGCTNSEGAFQCWCEAGYELRPTRRSCKALGPE
PVLLFANRIDIRQVLPHRSEYTLLLNNLENAIALDFHHRRELVFWSDVTLDRILRANLNG
SSVEEVVSTGLESPGGLAVDWVHDKLYWTDSGTSRIEVANLDGAHRKVLLWQNLEKPRAI
ALHPMEGTIYWTDWGNTPRIEASSMDGSGRRIIADTHLFWPNGLTIDYAGRRMYWVDAKH
HVIERANLDGSHRKAVISQGLPHPFAITVFEDSLYWTDWHTKSINSANKFTGKNQEIIRN
KLHFPMDIHTLHPQRQPAGKNRCGDNNGGCTHLCLPSGQNYTCACPTGFRKISSHACAQS
LDKFLLFARRMDIRRISFDTEDLSDDVIPLADVRSAVALDWDSRDDHVYWTDVSTDTISR
AKWDGTGQEVVVDTSLESPAGLAIDWVTNKLYWTDAXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXVLIGSQLPHPFGLTLYGERIYWTDWQTKSIQSADRQTGLDR
ETLQENLENLMDIHVFHRRRPPVSTPCALGNGGCSHLCLRSPTPSGFSCTCPTGINLMPD
GKTCSPGMNSFLIFARRIDIRMVSLDIPYFADVVVPVNVTMKNTIAIGVDPQEGKVYWSD
STLHRISRASLDGTQHEDITPKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLGYYIYWTDWQTRSIHRVN
KGTGSNVILVRSNLPGLMDIQAVDRTQPLGFNKCGPRNGGCSHLCLPRPSGFSCACPTGI
QLKGDGKTCDPSPETYLLFSSRGSIRRISLDTSDHTDVHIPIPELNNVISLDYDSVEGKV
YYTDVFLDVIRRADLNGSNMETVIGRGLKTTDGLAVDWVARNLYWTDTGRNTIEASRLDG
SCRKVLINNSLDEPRAIAVFPRKGYLFWTDWGHIAKIERANLDGSERKVLINTDLGWPNG
LTLDYDTRRIYWVDAHLDRIESADLNGKLRQILVSHVSHPFALTQQDRWIYWTDWQTKSI
QRVDKYSGRNKETVLANVEGLMDIIVVSLQRQTGTNACGVNNGGCTHLCFARASDFVCAC
PDEPDGRPCSLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCSE
KDVQLGLCSRPNEAIPAAPGEGLHVSYIIGGFLSILLILVVIAALMLYRHKKSKLTDPGM
GNLTYSNPSYRTSTQEVKIEAVPKPAMYNQLCYKKESGPDHNYTKEKIKIVEGICLLSGD
DAEWDDLKQLRSSRGGLLRDHVCMKTDTVSIQASSGSLDDTETEQLLQEEQSECSSVHTA
ATPERRGSLPDTGWKHERKLSSESQV
Download sequence
Identical sequences ENSEEUP00000001953 ENSEEUP00000001953

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]