SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000002218 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000002218
Domain Number 1 Region: 90-199
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0000000013
Family Regulator of G-protein signaling, RGS 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000002218   Gene: ENSEEUG00000002437   Transcript: ENSEEUT00000002428
Sequence length 506
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_2969:9514:23708:1 gene:ENSEEUG00000002437 transcript:ENSEEUT00000002428 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VFGQTPFYTVENSEWSLWPEIPYDLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXSMMKWKKADQWLFQKCIGGVRGMWRFCTYLRGSAGEELVDFWILVEQILSM
DEMDLENRDVYLSLLLVLKATYLQEGSRVVQLCNMNIKALLNLSIWHPNQSTSRRDVLSH
MQKMALFKLESYWLPNFYTHAKTVLAKEAACRGLMQEYETRLCSVCCNYLGELPLNMSVR
RGPCPQKRYSTRRAKRKMWQLLDRTSWFIDTEPQADSGPLSSQEPYPREEEEVLEKTSSK
GNNPCALGRELLRAEKARAKEKAKSQLHMEGLFDRNFTYLRTVTPFINHTAHXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXML
SHCYDDFLDEEDYWFLIFSVGGTLSW
Download sequence
Identical sequences ENSEEUP00000002218 ENSEEUP00000002218

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]