SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000002226 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000002226
Domain Number 1 Region: 202-245
Classification Level Classification E-value
Superfamily AXH domain 0.0000000000144
Family AXH domain 0.01
Further Details:      
 
Domain Number 2 Region: 433-505
Classification Level Classification E-value
Superfamily HMG-box 0.0000000209
Family HMG-box 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000002226   Gene: ENSEEUG00000002438   Transcript: ENSEEUT00000002437
Sequence length 511
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_1836:23395:40309:1 gene:ENSEEUG00000002438 transcript:ENSEEUT00000002437 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVWEVKTNQMPNAVQKLLLVMDKRTSGMNDSLELLQCNENLPSSPGYNSCDEHMELDDLP
ELQAVQSDPTQSAIYQLNSDVSHQEYPRSSWNQNTSEISENTYRENEVDWLTELANIATS
PQSPLMQCSFYNRSSPVHIIATSKSLHSYARPPPVSSSSKSEPAFPHHHWKEETPVRHER
ANSESESGIFCMSSLSDDDDLGWCNSWPSTSWHCFLKGTRLCFHKGSNKEWQDVEDFARN
EGCDNEEDLQMGTHKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYDFT
PLDSSAVYVLSSMARQRRASLSCGGPGGQDFARSGFSKNCGSPGSSQISSDSLCAKAVKN
HSSGTVNATSPQCRPDAFMLFAXXXXXXXXXXXXXXXXXAISVILGDRWKKMKNEERRMY
TLEAKALAEEQKRLNPDCWKRKRTNSGSQQH
Download sequence
Identical sequences ENSEEUP00000002226 ENSEEUP00000002226

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]