SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000002416 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000002416
Domain Number 1 Region: 186-238
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.85e-16
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 2 Region: 28-90
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.48e-16
Family KRAB domain (Kruppel-associated box) 0.0036
Further Details:      
 
Domain Number 3 Region: 294-346
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000553
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 4 Region: 224-273
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000178
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000002416   Gene: ENSEEUG00000002648   Transcript: ENSEEUT00000002640
Sequence length 362
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_8075:9473:39468:-1 gene:ENSEEUG00000002648 transcript:ENSEEUT00000002640 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PSAPWVPAVPQEGSTGDWEMAAALLAAGSQGLVTIKDVSLCFSQEEWRSLDPSQTDFYGE
YVMQENCGIVVSLRFPIPKLDMLSQLEGGEEQWVPDTQDMEERDILKVTYTGDGSEHEGD
TPELEAEPPRMLSSVSEETVLWNPEQDESWDALPRSSRGMFLGPPFLQEDSFSNLLCSTE
MDSLLRPHTCPQCGKQFVWGSHLARHQQTHTGERPYSCLKCEKSFGRRHHLIRHQKTHLH
DKPSRCSECGKNFRCNSHLASHQRVHTEGRPCRGQEGEECPGAQKQQRTPPVPKCHVCTE
CGKSFGRRHHLVRHWLTHTGEKPFQCPRCEKSFGRKHHLDRHLLTHQAQSPRSSWDRGTS
VF
Download sequence
Identical sequences ENSEEUP00000002416 ENSEEUP00000002416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]