SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000002942 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000002942
Domain Number 1 Region: 1864-2124
Classification Level Classification E-value
Superfamily YWTD domain 4.58e-45
Family YWTD domain 0.000011
Further Details:      
 
Domain Number 2 Region: 3840-4114
Classification Level Classification E-value
Superfamily YWTD domain 1.83e-43
Family YWTD domain 0.00000464
Further Details:      
 
Domain Number 3 Region: 3068-3259
Classification Level Classification E-value
Superfamily YWTD domain 1.57e-42
Family YWTD domain 0.00000764
Further Details:      
 
Domain Number 4 Region: 1557-1814
Classification Level Classification E-value
Superfamily YWTD domain 4.58e-42
Family YWTD domain 0.000029
Further Details:      
 
Domain Number 5 Region: 1285-1507
Classification Level Classification E-value
Superfamily YWTD domain 2.49e-40
Family YWTD domain 0.00000839
Further Details:      
 
Domain Number 6 Region: 2173-2442
Classification Level Classification E-value
Superfamily YWTD domain 8.89e-35
Family YWTD domain 0.0000315
Further Details:      
 
Domain Number 7 Region: 578-717
Classification Level Classification E-value
Superfamily YWTD domain 5.62e-23
Family YWTD domain 0.0000468
Further Details:      
 
Domain Number 8 Region: 299-441
Classification Level Classification E-value
Superfamily YWTD domain 1.57e-21
Family YWTD domain 0.00035
Further Details:      
 
Domain Number 9 Region: 1155-1236,1810-1859
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000526
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 10 Region: 825-867
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000497
Family LDL receptor-like module 0.0000883
Further Details:      
 
Domain Number 11 Region: 904-943
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000157
Family LDL receptor-like module 0.00079
Further Details:      
 
Domain Number 12 Region: 3622-3667
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000288
Family LDL receptor-like module 0.00099
Further Details:      
 
Domain Number 13 Region: 3341-3381
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000406
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 14 Region: 3457-3497
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000406
Family LDL receptor-like module 0.00078
Further Details:      
 
Domain Number 15 Region: 2665-2702
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000406
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 16 Region: 989-1027
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000445
Family LDL receptor-like module 0.000088
Further Details:      
 
Domain Number 17 Region: 949-986
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000524
Family LDL receptor-like module 0.00087
Further Details:      
 
Domain Number 18 Region: 3416-3455
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000995
Family LDL receptor-like module 0.00087
Further Details:      
 
Domain Number 19 Region: 3501-3540
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000103
Family LDL receptor-like module 0.00083
Further Details:      
 
Domain Number 20 Region: 3-43
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000127
Family LDL receptor-like module 0.00073
Further Details:      
 
Domain Number 21 Region: 2705-2739
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000131
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 22 Region: 1032-1072
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000144
Family LDL receptor-like module 0.00012
Further Details:      
 
Domain Number 23 Region: 2532-2572
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000183
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 24 Region: 2787-2823
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000275
Family LDL receptor-like module 0.00094
Further Details:      
 
Domain Number 25 Region: 2572-2611
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000681
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 26 Region: 2877-2912
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000013
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 27 Region: 2745-2779
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000183
Family LDL receptor-like module 0.00083
Further Details:      
 
Domain Number 28 Region: 2825-2864
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000327
Family LDL receptor-like module 0.00065
Further Details:      
 
Domain Number 29 Region: 120-166
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000373
Family EGF-type module 0.0052
Further Details:      
 
Domain Number 30 Region: 3711-3745
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000681
Family LDL receptor-like module 0.0024
Further Details:      
 
Domain Number 31 Region: 2496-2533
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000102
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 32 Region: 48-82
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000275
Family LDL receptor-like module 0.0023
Further Details:      
 
Domain Number 33 Region: 1118-1153
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000393
Family LDL receptor-like module 0.0024
Further Details:      
 
Domain Number 34 Region: 3308-3339
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000537
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 35 Region: 1081-1115
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000668
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 36 Region: 2630-2661
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000089
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 37 Region: 3383-3416
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000602
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 38 Region: 2127-2174
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000016
Family EGF-type module 0.011
Further Details:      
 
Domain Number 39 Region: 3664-3700
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000209
Family LDL receptor-like module 0.0027
Further Details:      
 
Domain Number 40 Region: 3754-3802
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000238
Family EGF-type module 0.054
Further Details:      
 
Domain Number 41 Region: 4166-4201
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000659
Family EGF-type module 0.042
Further Details:      
 
Domain Number 42 Region: 3793-3829
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000914
Family EGF-type module 0.01
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000002942
Domain Number - Region: 4203-4240
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000305
Family EGF-type module 0.042
Further Details:      
 
Domain Number - Region: 4239-4274
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00067
Family EGF-type module 0.041
Further Details:      
 
Domain Number - Region: 866-904
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000812
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number - Region: 94-127
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00559
Family EGF-type module 0.029
Further Details:      
 
Domain Number - Region: 4343-4382
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0126
Family EGF-type module 0.045
Further Details:      
 
Domain Number - Region: 463-497
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0126
Family EGF-type module 0.012
Further Details:      
 
Domain Number - Region: 4277-4310
Classification Level Classification E-value
Superfamily EGF/Laminin 0.067
Family EGF-type module 0.02
Further Details:      
 
Domain Number - Region: 4122-4154
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0686
Family EGF-type module 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000002942   Gene: ENSEEUG00000003042   Transcript: ENSEEUT00000003211
Sequence length 4513
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_3087:8917:146999:1 gene:ENSEEUG00000003042 transcript:ENSEEUT00000003211 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PKTCSPKQFACRDQVTCISKGWRCDGERDCPDGSDEAPEICPQSKAQRCQPNEHNCLGTE
LCIHMSHLCNGVQDCMDGSDEGAHCRELRGNCSQLGCQHHCVPTLSGPACYCNNSFQLQA
DGKTCKDFDECSVYGTCSQLCTNTDGSFLCGCVGGYLLQPDNRSCKAKNEPVGXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXVEQMAIDWLTGFYFDDIDDRXXXXXXKKWDTGVNDLDGGLY
NPRGIAVELTIGKVFFTDYGQIPKVERCDMDGQNRTKLVDSKIVFPHGITLDLVSRLVYW
ADAYLDYIEVVDYEGKGRQTIIQGILIEHLYGLTVFENYLYATNSDNANAQQKTSVIRVN
RFNSTDYQVVTRVDKGGALHIYHQRRQPRVRSHACENDQYGKPGGCSDICLLANSHKART
CRCRSGFSLGSDGKSCKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIHNVEGVAVDWMGNNLYWTDDGP
KKTISVARLEKAAQTRKTLIEGKMTHPRAIVVDPLNGWMYWTDWEEDPKDSRRGRLERAW
MDGSHRDVFVTSKTVLWPNGLSLDIPAGRLYWVDAFYDRIETILLNGTDRKIVYEGPEXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXSRQCACAEDQVLDSDGVTCLANPSYVPPPQCQPGEFACAN
SRCIQERWKCDGDNDCLDNSDEAPALCHQHTCPSDRFCENNRCIPNRWLCDVDIDCGNED
ESNATCSARTCPPNQFSCASGRCIPISWTCDLDDDCGDRSDESASCAYPTCFPLTQFTCN
NGRCININWRCDNDNDCGDNSDEAGCSHSCSSTQFKCNSGRCIPEHWTCDGDNDCGDYSD
ETHANCTNQATRPPGGCHTDEFQCRLDGLCIPLRWRCDGDTDCMDSSDEKSCEGVTHVCD
PNVKFGCKDSARCISKAWVCDGDSDCEDNSDEENCESLACRPPSHPCANNTSVCLPPDKL
CDGNDDCGDGSDEGELCDQCSLNNGGCSHNCSVAPGEGIVCSCPLGMELGPDNHTCQIQS
YCAKHLKCSQKCDQNKFSVKCSCYEGWVLEPDGESCRSLXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXSQSALYWTDVVEDIYGKLLDNGTLTSFEVVIQYGLATPE
GLAVDWIAGNIYWVESNLDQIEVAKLDGTLRTTLLAGDIEHPRAIALDPRDGILFWTDWD
ASLPRIEAASMSGAGRRTIHRETGSGGWPNGLTVDYLEKRILWIDARSDAIYSARYDGSG
HMEVLRGHEFLSHPFAVTLYGGEVYWTDWRTNTLAKANKWTGHNVTVVQRTNTQPFDLQV
YHPSRQPMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFKKFLLY
ARQMEIRGVDLDAPYYNYIISFTVPDIDNVTVLDYDAREQRVYWSDVRTQAIKRAFINGT
GVETVVSADLPNAHGLAVDWVSRNLFWTSYDTNKKQINVARLDGSFKNAVVQGLEQPHGL
VVHPLRGKLYWTDGDNIMANMDGKQRTLVFSGHRGPVSLAIDFPESKLYWISSGNHTINR
CNLDGSGLEVIEAMRSQLGKATALAIMGDKLWWADQVSEKMGTCNKADGSGAVVLRNSTT
LVMHMKVYDESIQLGHEGTNPCSVNNGDCSQLCLPTSESTRACMCTAGYSLRSGQQACEG
VGSFLLYSVHEGIRGIPLDPNDKSDALVPVSGTSLAVGIDFHAENDTIYWVDMGLSTISR
AKRDQTWREDVVTNGIGRVEGIAVDWIAGNIYWTDQGFDVIEVARLNGSFRYVIISQGLD
KPRAITVHPEKGYLFWTEWGQYPRIERSRLDGSERVVLVNVSISWPNGISVDYQDGKLYW
CDARMDKIERIDLETGENREVVLSSNNMDMFSVSVFEDFIYWSDRTHANGSIKRGSKDNA
TDSVPLRTGIGVQLKDIKVFNRDRQKGTNVCAVANGGCQQLCLYRGGGRRACACAHGMLA
EDGASCREYAGYLLYSERTILKSIHLSDERNLNAPVQPFEDPDHMKNVIALAFDYRAGTA
PGTPNRIFFSDIHFGNIQQINDDGSHRITIVENVGSVEGLAYHRGWDTLYWTSYTTSTIT
RHTVDQTRPGAFERETVITMSGDDHPRAFVLDECQNLMFWTNWNEQHPSIMRAALSGANV
LTLIEKDIRTPNGLAIDHRAEKLYFSDATLDKIERCEYDGSHRYVILKSEPVHPFGLAVY
GEHIFWTDWVRRAVQRANKFMGSDMKLLRVDIPQQPMGIIAVANDTNSXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVNSTCRAQDEFECANGECINFSLTCDGVS
HCKDKSDEKPSYCNSRRCKKTFRQCNNGRCVSNMLWCNGADDCGDGSDEIPCNKTACGLG
EFRCRDGTCIGNSSRCNQFVDCQDASDEMNCSATDCSSYFRLGVKGVRFQPCEHTSLCYA
PSWVCDGANDCGDYSDERDCPGVKRPRCPLNYFACPSGRCIPMSWTCDKEDDCEHGEDET
HCNKFCSEAQFECQNHRCISKQWLCDGTDDCGDGSDEAAHCEGKTCGPSSFSCPGTHVCV
PERWLCDGDKDCADGADESVTAGCLYNSTCDEREFMCQNRQCIPKHFVCDHDRDCADGSD
ESPECEYPTCGPEEFRCANGRCLSSRQWECDGESDCHDQSDEAPKNPHCTSPEHKCNASS
QFLCNSGRCVAETLLCNGLDDCGDGSDERGCHVNECLSRKLSGCSQDCEDLKIGFKXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXVLHRTGLSNPDGLAVDWVGGNLYWCDKGRDTIEVSKLNGAYRTVLVSSGLREPR
ALVVDVQNGYLYWTDWGDHSLIGRIGMDGSGRSVIVDTKITWPNGLTLDYVTERIYWADA
REDYIEFASLDGTNRHVVLSQDIPHIFALTLFEDYVYWTDWETKSINRAHKTTGANKTLL
ISTLHRPMDLHVFHALRQPDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXFVCKNDKCIPFWWKCDTEDDCGDHSDEPPDCPEFKCRPGQFQCSTGICTN
PAFICDGDNDCQDNSDEANCDIHVCLPSQFKCTNTNRCIPGIFRCNGQENCGDGEERCSE
VTCAPNQFQCSITKRCIPRVWVCDRDNDCVDGSDEPANCTQMTCGVDEFRCKDSGRCIPA
RWKCDGEDDCGDGSDEPKEECDERTCEPYQFRCKNNRCVPGRWQCDYDNDCGDNSDEESC
RPTPWPESEFPGANGCCIRRWNCDGDHDCANVPFRXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXRTCPLDEFQCNNTLCKPLAWKCDGEDDCGDNSDENPEECA
RFVCPPNRPFRCKNDRVCLWIGRQCDGTDNCGDGTDEEDCEPPTPQSAHCKDKKEFLCRD
QRCLPSSLRCNMFDDCGDGSDEEDCSIDPKMTSCATNTSLCGDEERCVRTEKAAYCACRP
GFHTVPGHSGCQDINECLRFGACSQLCNNTKGSHLCSCARNFMKTHNTCKAEGSEYQVLY
IADDNEIRSLFPSHPHSAYEQAFQGDESVRIDAMDVHVKAGCVYWTNWHTGTISYRSLLS
AASPTTSNRHRRQIDRGVTHLNISGLKMPRGIAIDWVAGNVYWTDSGRDVIEVAQMKGEN
RKTLISGMIDEPHAIVVDPLRGTMYWSDWGNHPKIETAAMDGTLRETLVQDSIQWPTGLA
VDYHNERLYWADAKLSVIGSIRLNGTDPIVAADSKRGLSHPFSIDVFEDYIYGVTYINNR
VFKIHKFGQSPLVNLTGGLSHASDVVLYHQHKQPEVTNPCDRKKCEWLCLLSPSGPVCTC
PNGKRLDNGTCVAVPSPTPPPDAPRPGTCNLQCFNGGSCFLNARKQPKCRCQPRYTGDKC
ELDQCWEYCRNGGTCAASPSGMPTCRCPTGFTGPKCTQQVCAGYCANNSTCTVNQGNQPQ
CRCLPGFLGDRCQYRQCSDYCENLGTCQMAADGTRQCRCTAYFEGPRCEVNKCSRCLDGT
CAVNKQSGDVTCNCTDGRVAPSCLSCLGHCSNGGSCTMNSKMMPECQCPPHMSGPRCEDP
VVSQQQPAHMASILIPLLLLLLVLLIAGTVFWYKRRVRGAKGFQHQRMTNGAMNVEIGNP
TYKMYEGGEPDDVGGLLDADFALDPDKPTNFTNPVYATLYMGGHGSRHSLASTDEKRELL
GRGPEDEIGDPLA
Download sequence
Identical sequences ENSEEUP00000002942 ENSEEUP00000002942

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]