SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000002983 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000002983
Domain Number 1 Region: 228-405
Classification Level Classification E-value
Superfamily MIR domain 1.48e-50
Family MIR domain 0.0017
Further Details:      
 
Domain Number 2 Region: 670-818
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000791
Family SPRY domain 0.052
Further Details:      
 
Domain Number 3 Region: 111-193
Classification Level Classification E-value
Superfamily MIR domain 0.00000275
Family MIR domain 0.021
Further Details:      
 
Domain Number 4 Region: 1138-1202
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000427
Family SPRY domain 0.038
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000002983
Domain Number - Region: 2155-2221
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.000196
Family IP3 receptor type 1 binding core, domain 2 0.025
Further Details:      
 
Domain Number - Region: 1420-1541
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000277
Family SPRY domain 0.038
Further Details:      
 
Domain Number - Region: 3995-4042
Classification Level Classification E-value
Superfamily EF-hand 0.00471
Family Eps15 homology domain (EH domain) 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000002983   Gene: ENSEEUG00000003071   Transcript: ENSEEUT00000003259
Sequence length 4946
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_8520:144:678936:1 gene:ENSEEUG00000003071 transcript:ENSEEUT00000003259 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGARARMRSSSCELXXXXXXXXXXXXXKNNRNYAWWQKDLATDFVSWRLLQIPRMFLQTS
LSAPLCWNSPSLSGPFKRCLLTPWRNQKGQVDVEKWKFMMESAQGSGHRTLLYGHAILLR
HSYSGMYLCCLSTSRSSTDKLAFDVGLQEDTTGEACWWTIHPASKQRSEGEKVRVGDDLI
LVSVSSERYLHLSYGNGSLHVDAAFQQTLWSVAPISSGSEAAQGYLIGGDVLRLLHGHMD
ECLTVPSGEHGEEQRRTVHYEGGAVSVHARSLWRLETLRVAWSGSHIRWGQPFRLRHVTT
GKYLSLMEDKNLLLMDKEKADVKSTAFAFRSSKEKLDVGIRKEVDGMGTSEIKYGDSVCY
IQHVNTGLWLTYQSVDVKSVRMGSIQRKAIMHHEGHMDDGLNLSRSQHEESRTARVIRST
VFLFNRFIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXALIR
GNRKNCAQFSGSLDWLISRLERLEASSGILEVLHCVLVESPEALNIIKEGHIKSIISLLD
KHGRNHKVLDVLCSLCVCHGVAVRSNQHLICDNLLPGRDLLLQTRLVNHVSSMRPNIFLG
VSEGSAQYKKWYYELMVDHTEPFVTAEATHLRVGWASTEGSSPYPGGGEEWGGNGVGDDL
FSYGFDGLHLWSGCIARTVSSPNQHLLRTDDVISCCLDLSAPSISFRINGQPVQGMFENF
NIDGLFFPVVSFSAGIKLRFLLGGRHGEFKFLPPPGYAPCYEAVLPKEKLKVEHSREYKQ
ERTYTRDLLGPTVPLTQAAFTPIPVDTTQIVLPPHLERIREKLAENIHELWVMNKIELGW
QYGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXYQLTSGYKPAPMDLSFIKLTPSHEAMVGKLAENAHNVWARDRIRQGWTYGIQQ
NNVDPRLVPYALLDARTKKSNKDSLREAVRTLLGYGYNLEAPDQDHXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAQRW
HQGNEHYGRSWQAGDVVGCMVDMTEHTMMFTLNGEILLDDSGSELAFKDFDVGDGFIPVC
SLGVAQVGRMNFGKDVSTLKYFTICGLQEGYEPFAVNTNRDITMWLSKRLPQFLQVPSNH
EHIEVTRIDGTIDSSPCLKITQKSFGSQHSSTDIMFYRLSMPIECAEVFSKTAAGGLPGA
GLFGPKNDLEDYDADSDFEVLMKTAHGHLVPDRVDKDKEATKPEFNNHKDYAQEKPSRLK
QRFLLRRTKPDYSTSHSARLTEDVLADDRDDFDYLMQTSTYYYSVRIFPGQEPANVWVGW
ITSDFHQYDTGFDLDRVRTVTVTLGDEKGKVHESIKRSNCYMVCAGESMSPGQGRNNNGL
EIGCVVDAASGLLTFTANGKELSTYYQVEPSTKLFPAVFAQATSPNVFQFELGRIKNVMP
LSAGLFKSEHKNPVPQCPPRLHVQFLSHVLWSRMPNQFLKVDVSRISERQGWLVQCLDPL
QFMSLHIPEENXXXXXXXXXXXXXXXXXXXXXXXXXXAVCALGNHRVAHALCSHVDEPQL
LYAIENKYMPGLLRAGYYDLLIDIHLSSYATARLMMNNEFIVPMTEETKSITLFPDENKK
HGLPGIGLSTSLRPRMQFSSPSFVSINNDYYQYSPEFPLDILKAKTIQMLTEAVKEGRLH
ARDPVGGTTEFLFVPLIKLFYTLLIMGIFHNEDLKHILQLIEPSVFKEAALPEEESEVPE
KDLATENSKQEGAGEEEAKGGKRPKEGLLQMKLPEPVKLQXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXINMLLNFKDDKNE
CPCPEEIRDQLLDFHEDLMTHCGIELDEDGSLDGNNDLTIRGRLLSLVEKVTYLKKKQAE
KPVESASQKSSTLQQLISETMVRWAQESVIEDPELVRAMFMLLHRQYDGIGGLVRALPKT
YTINGVSVEDTISLLASLGQIRSLLSVRMGKEEEKLMIRGLGDIMNNKVFYQHPNLMRAL
GMHETVMEVMXXXXXXXXXXEITFPKMVANCCRFLCYFCRISRQNQKAMFDHLSYLLENS
SVGLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVVRYLAGCGLQSCQMLVSKGY
PDIGWNPVEGERYLDFLRFAVFCNGESVEENANVVVRLLIRRPECFGPALRGEGGNGLLA
AMEEAIKIAEDPCRDGPSPTSGSSKTLDTEDEEDDTIHMGNAIMTFYAALIDLLGRCAPE
MHIHAGKEEAIRIRSILRSLIPLGDLVGVISIAFQMPTIAKDGNVVEPDMSAGFCPDHKA
AMVLFLDRVYGIEVQDFLLHLLEVGFLPDLRAAASLDTAALSATDMALALNRYLCTAVLP
LLTRCAPLFAGTEHHASLIDSLLHTVYRLSKGCSLTKAQRDSIEVCLLSICGXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXLLTNHYERCWKYYCLPGGWGNFGAASEEELHLSRKLFW
GIFDALSQKKYEQELFKLALPCLSAVAGALPPDYMESNYVSMMEKQSSMDSEGNXXXXXX
XXXXXXXXXXLEYFIDYAEHSHDKWSMDKLANGWIYGEIYSDSSKVQPLMKPYKLLSEKX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGGS
RSKGEHFPYEQEIKFFAKVVLPLIDQYFKNHRLYFLSAASRPLCSGGHASNKEKEMVTXX
XXXXXXXXXXXXXXXXNDATSIVNCLHILGQTLDARTVMKTGLESVKSALRAFLDNAAED
LEKTMENLKQGQFTHTRNQPKGVTQIINYTTVALLPMLSSLFEHIGQHQFGEDLILEDVQ
VSCRILTSLYALGTSKSIYVEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXLSLPANVEDMCPNIPSLEKLMEEIVELAESGIRYTQMPHVMEVILPMLCSYMSR
WWEHGPENNPDRAGMCCTALNSEHMNTLLGNILKIIYNNLGIDEXXXXXXXXXFSQPIIN
KVKPQLLKTAVLALMEKLEKAMVVSEDHLAEAXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXAKWLKEPNPEAEDLFRMVAEVFIYWSKSHNFKREEQNFVVQNEINNMSFLI
TDTKSKMSKAAVSDQERKKMKRKGDRYSMQTSLIVAALKRLLPIGLNICAPGDQELIALA
KNRFSLXXXXXXXXXXXXXXXXXXXXLEDPAIRWQMALYKDLPNRTEDTSDPEKTVERVL
DIANVLFHLEQKSTFIYRRYYGLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XHRAVNLFLQGYEKSWIETEEHYFEDKLIEDLAXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXKLEEDFLYMAYADIMAKSCHDEEDDDGEEEVKSFEEKEMEKQKLLYQQARLH
DRGAAEMVLQTISASKGETGPMVAATLKLGIAILNGGNSTVQQKMLDYLKEKKDVGFFQS
LAGLMQSCSVLDLNAFERQNKAEGLGMVTEEGSXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXGPCTGNQQSLAHSRLWDAVVGFLHVFAHMQMKLSQDSSQIELLKELM
DLQKDMVVMLLSMLEGNVVNGTIGKQMVDMLVESSNNVEMILKFFDMFLKLKLTSSDTFK
EYDPDGKGVISKRDFHKAMESXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAKKIKAELLAMP
DPTQDEVRGDAEKGEKPMESALPSEDLTDLKELTEESDLLSDIFGLDLKREGGQYKLIPH
NPNAGLSDLISNPNPVPEVQEKFQQAKEEKGAKEENSPEKAXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNYFARNFYNMRMLALFVAFAINFILLFYK
VSTSSVVEGKELPPRSSNENVKVSTLDDDAQRIIAVHFVLEESSGYMEPTLRILAILHTV
ISFFCIIGYYCLKVPLVIFKREKEVARKLEFDGLYITEQPSEDDIKGQWDRLVINTQSFP
NNYWDKFVKRKVIDKNEEFYGRDRIRELLGMDKTALDFPEARDTKXXXXXXXXXXXLNSI
DVKYQMWKLGVVFTDNSFLYLAWYMTMSVLGHYNNFFFAAHLLDIAMGFKTLRTILSSVT
HNGKQLVLTVGLLAVVVYLYTVVAFNFFRKFYNKSEDGDTPDMKCDDMLTCYMFHMYVGV
RAGGGIGDEIEDPAGDEYEIYRIIFDITFFFFVIVILLAIIQGLIIDAFGELRDQQEQVK
EDMEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFFLMYLINKDETEHTGQESYVW
KMYQERCWEFFPAGDCFRKQYEDQLN
Download sequence
Identical sequences ENSEEUP00000002983 ENSEEUP00000002983

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]