SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000003025 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000003025
Domain Number 1 Region: 7-25,95-288
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.9e-53
Family Ankyrin repeat 0.000082
Further Details:      
 
Domain Number 2 Region: 768-839
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000000000275
Family SAM (sterile alpha motif) domain 0.0048
Further Details:      
 
Domain Number 3 Region: 695-763
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000628
Family SAM (sterile alpha motif) domain 0.011
Further Details:      
 
Domain Number 4 Region: 905-971
Classification Level Classification E-value
Superfamily PH domain-like 0.000000063
Family Phosphotyrosine-binding domain (PTB) 0.0083
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000003025
Domain Number - Region: 1048-1068
Classification Level Classification E-value
Superfamily PH domain-like 0.0523
Family Phosphotyrosine-binding domain (PTB) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000003025   Gene: ENSEEUG00000003282   Transcript: ENSEEUT00000003305
Sequence length 1116
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_543:884:199505:1 gene:ENSEEUG00000003282 transcript:ENSEEUT00000003305 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKEQELLEAARTGHLPAVEKLLSGKRLSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDVVEVLLRNDALTNVADSKGCYPLHLA
AWKGDAQIVRLLIHQGPSHTRVNEQNNDNETALHCAAQYGHTEVVKVLLEELTDPTMRNN
KFETPLDLAALYGRLEVVKMLLNAHPNLLSCNTKKHTPLHLAARNGHKAVVQVLLDAGMD
SNYQTEKGSALHEAALFGKTDVVQILLTAGIDVNIKDNRGLTALDTVRELPSQKSQQIAA
LIEDHMTGKRNAKEVDKTPTPQPTLISNLDSISQKSQGDVEKAVTELIIGFDTNAEEEGP
YEALYNAVSCHSLDSMASGRSSDHDSMNKESETTGVKTAGMRPXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXVLALRPRIQGSAAREEDEHPYELLLTAETKKFVSVDGKIKDHRRSS
SSRSQDSVEGQDGQVPEQFSGLLHGSSPVCEVGQDPFQLLSVTGQSHSEGSPAQGACHEA
SMQLEETGLHAPGASPPSVLDQSKRVGYPAGLPTTSSQSHPETLTLVASPHPGGAEEEGD
RSEARSRAPPTSKPKAELKLSRSLSKSDSDLLTCSPTEDTTMGSRSESLSNCSIGKKRLE
KSPSFASEWDEIEKIMSSIGEGIDFSQEQQKISGSRTLEQSVGEWLEAVGLQQYXXXXXX
XXXXXXXXXGPNVMEEQDLREIGISDPQHRRKLLQAARSLPKVKALGYDGTSPPSVPSWL
DSLGLQDYVHSFLSSGYSSLDTVKNLWELELVNVLKVHLLGHRKRIIASLADRPYEEPPQ
KPPRFSQLRCQDLFSQTSSPLSQNDSCTGRSADLLLPHGDTSRRRHDSLHDPAAPSRVER
FRMQEEHREAKLTLRPPSLAAPYAPVQSWQHQPEKLIFESCGYEANYLGSMLIKDLRGTE
STQDACAKMRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXNLTYEIILTLGQAFEVAYQLALQAQKSKPMGATAA
EMIETKSSKPVPKPRVGMRKSALPPDTDQDAQSHAS
Download sequence
Identical sequences ENSEEUP00000003025 ENSEEUP00000003025

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]