SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000003211 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000003211
Domain Number 1 Region: 284-468
Classification Level Classification E-value
Superfamily YWTD domain 7.19e-38
Family YWTD domain 0.0000623
Further Details:      
 
Domain Number 2 Region: 1260-1451
Classification Level Classification E-value
Superfamily YWTD domain 3.66e-37
Family YWTD domain 0.0000117
Further Details:      
 
Domain Number 3 Region: 1912-2120
Classification Level Classification E-value
Superfamily YWTD domain 8.76e-27
Family YWTD domain 0.00013
Further Details:      
 
Domain Number 4 Region: 598-730
Classification Level Classification E-value
Superfamily YWTD domain 3.66e-23
Family YWTD domain 0.0000811
Further Details:      
 
Domain Number 5 Region: 2329-2451
Classification Level Classification E-value
Superfamily YWTD domain 4.05e-20
Family YWTD domain 0.00041
Further Details:      
 
Domain Number 6 Region: 3888-4066,4112-4166
Classification Level Classification E-value
Superfamily YWTD domain 2.88e-17
Family YWTD domain 0.00086
Further Details:      
 
Domain Number 7 Region: 3140-3267
Classification Level Classification E-value
Superfamily YWTD domain 0.00000000000000314
Family YWTD domain 0.0008
Further Details:      
 
Domain Number 8 Region: 1645-1781
Classification Level Classification E-value
Superfamily YWTD domain 0.00000000000000942
Family YWTD domain 0.00045
Further Details:      
 
Domain Number 9 Region: 2888-3004,3256-3314
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000143
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 10 Region: 3754-3794
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000641
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 11 Region: 876-921
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000196
Family LDL receptor-like module 0.00069
Further Details:      
 
Domain Number 12 Region: 3470-3507
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000209
Family LDL receptor-like module 0.00094
Further Details:      
 
Domain Number 13 Region: 2756-2792
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000419
Family LDL receptor-like module 0.00084
Further Details:      
 
Domain Number 14 Region: 3627-3664
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000432
Family LDL receptor-like module 0.00088
Further Details:      
 
Domain Number 15 Region: 3549-3586
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000628
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 16 Region: 1004-1041
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000733
Family LDL receptor-like module 0.00026
Further Details:      
 
Domain Number 17 Region: 840-880
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000126
Family LDL receptor-like module 0.00055
Further Details:      
 
Domain Number 18 Region: 3351-3388
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000144
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 19 Region: 3588-3626
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000432
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 20 Region: 3670-3714
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000055
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 21 Region: 2585-2622
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000707
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 22 Region: 2715-2753
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000157
Family LDL receptor-like module 0.00085
Further Details:      
 
Domain Number 23 Region: 3506-3546
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000183
Family LDL receptor-like module 0.00094
Further Details:      
 
Domain Number 24 Region: 3391-3428
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000183
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 25 Region: 31-65
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000785
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 26 Region: 962-1003
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000122
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 27 Region: 2637-2672
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000124
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 28 Region: 1174-1219
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000167
Family EGF-type module 0.014
Further Details:      
 
Domain Number 29 Region: 1134-1169
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000445
Family LDL receptor-like module 0.0026
Further Details:      
 
Domain Number 30 Region: 797-834
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000838
Family EGF-type module 0.019
Further Details:      
 
Domain Number 31 Region: 3806-3848
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000838
Family EGF-type module 0.018
Further Details:      
 
Domain Number 32 Region: 1536-1585
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000662
Family EGF-type module 0.023
Further Details:      
 
Domain Number 33 Region: 1108-1131
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000072
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 34 Region: 3716-3748
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000942
Family LDL receptor-like module 0.0036
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000003211
Domain Number - Region: 3012-3069
Classification Level Classification E-value
Superfamily YWTD domain 0.000144
Family YWTD domain 0.0024
Further Details:      
 
Domain Number - Region: 1223-1259
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000148
Family EGF-type module 0.014
Further Details:      
 
Domain Number - Region: 3841-3877
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00036
Family EGF-type module 0.005
Further Details:      
 
Domain Number - Region: 4285-4320
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000474
Family EGF-type module 0.034
Further Details:      
 
Domain Number - Region: 483-517
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00943
Family EGF-type module 0.017
Further Details:      
 
Domain Number - Region: 2464-2501
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0591
Family EGF-type module 0.019
Further Details:      
 
Domain Number - Region: 124-155
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0718
Family EGF-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000003211   Gene: ENSEEUG00000003342   Transcript: ENSEEUT00000003523
Sequence length 4595
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_6737:14718:1121635:-1 gene:ENSEEUG00000003342 transcript:ENSEEUT00000003523 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEFLLAFLTLSGLLPIAKVLTVGADRDQQLCDPGEFLCHDHVTCVSQSWLCDGDADCPD
DSDESLDIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLLPNC
QKLNCQYKCAIMRNSTRCYCEDGFEVKEDGRSCKXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVQQMAIDWLTRNLYFV
DHVSDRIFVCNYNGSVCVTLIDLELHNPKAIAVDPIAGKLFFTDYGNVAKVERCDMDGMN
RTRIIDSKTEQPAALALDLVNKLVYWVDVYLDYVEVVDYQGKNRYTIIQGRQVRHLYGIA
VFEDYLYATSSDNSNIIKINRFNGTDTHSLMKMENARGIRIYQKRMQPTVRSHACEVDPY
GKPGGCSHICLLSSNYKTRTCRCRTGFNLGSDGRSCKXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLDN
VEGIAVDWIGNNLYWTNDGHRKTINVARLEKTSQSRKTLLEGEMSHPRGIVVDPVNGWMW
TDWEEDEIDDSVGRIEKAWMDGFNRQIFVTSKMLWPNGLTLDSQTNTLYWCDAYYDHIEK
VFLNGTHRKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXDNMCRVNNGGCSTLCLAIPGSRVCACADNQLLDEHGTTCMFNPGEVM
PHICNSGEFRCKNRHCIQDRWKCDGDDDCLDGSDEDSINCFNHSCPDDQFKCKNNRCIPK
RWLCDGANDCGSSEDESNETCAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXFPTCEPLTFICKSGRCISSKWHCDSGNNDDCGDGSDEVGCVHSCFENQFRCSSGRCIP
GHWACDGDNDCGDFSDETQVNCTKEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXRCINRAWVCDGDIDCEDQSDEDNCDSFLCGPPK
YPCANDTSVCLQPEKLCNGRRDCPDGSDEGSLCDECSLNNGGCSNHCSVVPGRGIVCSCP
EGLQLNKDNKTCEIVDFCSSHLKCSQVCEQHKHTVKCSCYEGWKLDVDGEGCTSIDPFEA
FIIFSIRHEIRRIDLHKRDYSLLVPGLRNTIALDFHFNQSLLYWTDVVEDRIYRGKLSES
GGVSAIEVVVEHGLATPEGLTVDWIAGNIYWIDSNLDQIEVAKLDGSSRTTLIAGAMEHP
RAIALDPRYGLLFWTDWDANFPRIESASMSGSARKTIYKDMKSGAWPNGLTVDHFEKRIV
WTDARSDAIYSAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXPNPCAANDGKGPCSHMCLIDHNRSAACACPHLM
KLSSDKKTCYEKKKFLLYARRSEIRGVDIDNPYFNFITFTVPDDDTVIDFDASXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXIQSIRGLAVDWISRNVYWISSEFDETQINVARLDGS
LKTSIIHGIDKPQCLAAHPVRGKLYWTDGNTINMANMDGSNSKILFQNQKEPIXXXXXXX
XXXXXWISSGNGTINRCNLDGGNLEVIESMKEELTKATALTIMXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDFHAENDT
VYWTDMGFNKISRAKRDQTWKEDIITNGLGRVEGIAIDWIAGNIYWTDHGLSXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXYLFWTEWGQLPCIGKARLDGSEKVVLVSMGIAW
PSGISIDYEENKVYWCDARTDKIERIDLETGGNREVVLSGSNVDMFSVAVFGAYIYWSDR
AHANGSIRRGHKNDATEAITMRTGLGVNLKEVKIFNRVREKXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIHLSDETNFNSIRPYENPDYFK
NVIALPFDYNQRRGTNRIFYSDAHFGNIQLIKDNWEDRQVIVEXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLMFWTNWNEQHPS
IMRCALTGKNTQVVISTDILTPNGLTIDHRAEKLYFSDGSLGKIERCEYDGSQRHVIVKT
GPGTFLSLAVYDNYIFWSDWGRRAILRSNKYTGGDTKILRSDIPHQPMGIIAVANDTNSC
ELSPCALLNGGCQDLCLLTPNGKVNCSCRGDRILLDDNRCVXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXSTCTTVEFHCTDGTCIPRSARCNQIIDCADASDEKNCNNTDCTHFYKLGVKTTGF
IKCNSTSLCVLPTWICDGSNDCGDYSDELKCPXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXSSCSWSQFACSAQKCISRHWICDGEDDCGDGLDESNDICGAVTCAA
GMFSCQGSHACVPRHWLCDGERDCPNGSDELSTAGCXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXQSCNSSFFMCKNGRCIPNGSLCDIKDDCGDGSDERNCHLNECLSKKVSGCSQDCQ
DLPVSYKCKCWPGFQLKDDGKTCVDIDECSLGFPCSQRCINTYGTYKCLCTDGYEIHPDN
PKGCRSLSDEEPFLILADHHEIRKISTDGSNYTLIKQGLNNVISIDFDYREEFIYWIDSS
RPNGSRINRMCFNGSDVKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXYLYWIDCCEYPHIGRVGMDGTNQSVVVESKISRPMALTIDY
VNHRLYWADENHIEFSNMDGSHRHKXXXXXXXXVIALTLFEDYIYWTDGKTKSLSRAHKT
SGADRLSLINSWHAITDIQVYHPYRQPNVSKHLCMINNGGCSHLCLLAPGKTHACACPTN
FYLAADNRTCLSNCTASQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEFKCQPGRFQ
CGTGLCALPAFICDGENDCGDNSDELNCDTHVCLSGQFKCTKNQKCIPINLRCNGQDDCG
DEEDERDCXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKKTCGPHEFQC
KNNNCIPDHWRCDSQNDCSDNSDEENCKPQTCTLKDFLCSNGDCVSSRFWCDGDFDCADG
SDERYCETSCSKDQFQCSNGQCISVKWKCDGHEDCKYGEDEKNCAPVSPTCSSSEYICAS
GGCVTAFLKCNGEDDCADGSDEMDCVTECKEDQFRCRNKAHCIPIRWLCDGIQDCVDGSD
EGNCDRGADICREDEFLCNNSLCKLHFWVCDGEDDCGDNSDEDPDMCVKFHCPPTRPHRC
RNSRICLQPEKICNDVDDCGDNSDEDHCGGKVTYKARPCKKDEFACSNKKCIPMDLQCDR
LDDCGDGSDEQACRMIPTEYTCEDNVNPGGDDAYCNQIKTSVFCRCKPGFQRNMKNRQCE
DLNECLAFGTCSHQCINMEGSYKCVCDQNFQERNSTCIAKGSEDQVLYIANDTDILGFIY
PFNYSGNHQQISHIEHNSRITGMDVYYQRDIIIWSTQFNPGGIFYKRIHGREKRQANSGL
ICPEFKRPRDIAVDWVAGNIYWTDHSRMHWFSYYTTHWTSLRYSINVGQLNGPNCTRLLT
NMAGEPYAIALNPKKGMMYWTVVGDRSHIEEAAMDGTLRRILVQKNLQRPTXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLLHPHRIDVFEDYIYGAGSKNGVFRVQKF
GHGSVEYLPLDVEKTKGVLISHRYKQLDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXRPTCSCALGFTGPNCGKTVCEDFCQNGGTCSVTPGNQPYCHCQPEHTGDRCQYY
VCHHYCVNSESCTIGDDGRVECVCPTRYEGAKCEIDKCIRCHGGHCINKGSEDIFCXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCSSNWSGTQCERPAPKSSKSDHINTRSV
AIIVPLVLLVTLITTLVIGLVLCKRKRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXARYIGGGPSAFKLPHTAPPIYLNSDLKGPLTTGPTNYSNPVYAK
LYMDGQNCRNSLGSVDERKELLPKKIEIGIRETVA
Download sequence
Identical sequences ENSEEUP00000003211 ENSEEUP00000003211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]