SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000003448 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000003448
Domain Number 1 Region: 322-403
Classification Level Classification E-value
Superfamily HMG-box 1.2e-20
Family HMG-box 0.0000075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000003448   Gene: ENSEEUG00000003751   Transcript: ENSEEUT00000003783
Sequence length 564
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_5268:83082:208688:1 gene:ENSEEUG00000003751 transcript:ENSEEUT00000003783 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GAARGEDDLRANDELILFQDEGGEEQGPSSDSASAQRDLDEVKSSLVNESETQSSSSDSE
AERRPQPARDAFQKPRDFFAEVRRPQDGAFFKGPPYPGYPFLMIPDLSSPYLPNGPLSPG
GARTYLQMKWPLLDVPSSATVKDTRSPSPAHLSNKVPVVQHPHHMHPLTPLITYSNDHFS
PGSPPTHLSPEIDPKTGIPRPPHPSELSPYYPLSPGAVGQIPHPLGWLVPQQGQPMYSLP
PGGFRHPYPALAMNASMSSLVSSRFSPHMVAPAHPGLPTSGIPHPAIVSPIVKQEPAPPS
LSPAVSAKSPVTVKKEEEKKPHVKKPLNAFMLYMKEMRAKVVAECTLKESAAINQILGRK
WHNLSREEQAKYYELARKERQLHSQLYPTWSARDNYGKKKKRKREKQLSQTQSQQQVQET
EGALASKSKKPCVQYLPPEKPCDSPASSHGSMLDSPATPSAALASPAAPAATHSEQAQPL
SLTTKPESRAQLALHSAAFLSAKAAATSGQMGSQPPLLSRPLPLGSMPTALLTSPPSFPA
TLHAHQALPVLQAQPLSLVTKSAH
Download sequence
Identical sequences ENSEEUP00000003448 ENSEEUP00000003448

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]