SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000003488 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000003488
Domain Number 1 Region: 1-120
Classification Level Classification E-value
Superfamily Transcription factor STAT-4 N-domain 5.36e-42
Family Transcription factor STAT-4 N-domain 0.0000256
Further Details:      
 
Domain Number 2 Region: 579-695
Classification Level Classification E-value
Superfamily SH2 domain 2.96e-40
Family SH2 domain 0.000000417
Further Details:      
 
Domain Number 3 Region: 354-458
Classification Level Classification E-value
Superfamily p53-like transcription factors 3.73e-31
Family STAT DNA-binding domain 0.00000141
Further Details:      
 
Domain Number 4 Region: 187-269
Classification Level Classification E-value
Superfamily STAT 2.75e-26
Family STAT 0.00000619
Further Details:      
 
Domain Number 5 Region: 538-578
Classification Level Classification E-value
Superfamily p53-like transcription factors 0.000000000000663
Family STAT DNA-binding domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000003488   Gene: ENSEEUG00000003791   Transcript: ENSEEUT00000003825
Sequence length 773
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_3299:94671:139110:-1 gene:ENSEEUG00000003791 transcript:ENSEEUT00000003825 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNL
LGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAA
TAAQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRSIVSELAGLLSAMEYVQKTLTD
EELADWKRRQQIACIGGPPNICLDRLENXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLLVKFPE
LNYQLKIKVCIDKDSGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQR
CGNGGRANCDASLIVTEELHLITFETEVYHQGLKIDLEXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPGV
NYSGCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAI
LSTKPPGTFLLRFSESSKEGGVTFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAEIIMGY
KIMDATNILVSPLVYLYPDIPKEEAFGKYCRPESQXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSLTFDMELTSECATSPM
Download sequence
Identical sequences ENSEEUP00000003488 ENSEEUP00000003488

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]