SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Erinaceus europaeus 69 > ENSEEUP00000003802

Domain assignment for ENSEEUP00000003802 from Erinaceus europaeus 69

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSEEUP00000003802
Domain Number 1	Region: 68-138
Classification Level	Classification	E-value
Superfamily	Immunoglobulin	4.62e-18
Family	I set domains	0.021
Further Details:

Domain Number 2	Region: 266-358
Classification Level	Classification	E-value
Superfamily	Immunoglobulin	0.0000000000000663
Family	I set domains	0.012
Further Details:

Domain Number 3	Region: 411-476
Classification Level	Classification	E-value
Superfamily	TSP-1 type 1 repeat	0.0000000000523
Family	TSP-1 type 1 repeat	0.0035
Further Details:

Domain Number 4	Region: 183-250
Classification Level	Classification	E-value
Superfamily	Immunoglobulin	0.00000000717
Family	I set domains	0.02
Further Details:

Domain Number 5	Region: 538-594
Classification Level	Classification	E-value
Superfamily	TSP-1 type 1 repeat	0.0000000366
Family	TSP-1 type 1 repeat	0.0055
Further Details:

Weak hits

Sequence:	ENSEEUP00000003802
Domain Number -	Region: 476-535
Classification Level	Classification	E-value
Superfamily	TSP-1 type 1 repeat	0.000103
Family	TSP-1 type 1 repeat	0.0083
Further Details:

Domain Number -	Region: 357-416
Classification Level	Classification	E-value
Superfamily	TSP-1 type 1 repeat	0.017
Family	TSP-1 type 1 repeat	0.0082
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Biological Process	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSEEUP00000003802 Gene: ENSEEUG00000004172 Transcript: ENSEEUT00000004183
Sequence length	631
Comment	pep:novel genescaffold:HEDGEHOG:GeneScaffold_7456:10010:189900:1 gene:ENSEEUG00000004172 transcript:ENSEEUT00000004183 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	VAIPPHKHVSGFSSSLRTLSSGEAGGSPRRPHRKPTILRKISAAQQLSASEVVTHLGQTV ALASGTLSVLLHCEASGNPRPTISWARNGEEVQFSDRILLQPDDSLQILAPVEADVGFYT CNATNALGYDSVSIAVTLAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX XXXVPEAEVTWFRNKSKLSSPLHLHEGSLLLANVSFSDQGLYSRRAANLHGELTENTQLL ILDPPQVPVQLDDIKALLSATGLNLPSVLTSPLGTQLVLNPGNSALLGCPIRGHPTPNIT WFHGGQPVATVTGLTHYILEAGQILQVANLSSDSQGEFSCLAQNEAGALRQKASIVIQDY WWSVDRLATCSASLGNRGVHTPRLRCLLNSTEVHPIHCAGKVRPAVQSIACHRRTCFWMV TSWSACTRSCGGGVQTRRVTCQKLKASGISTPVPNEMCTQLAKRPVDTQACNQQLCVEWA FSSWGQCNGPCIGPRLAVQHRQVFCQTRDGLTLPSEQCSALPRPVSTQNCWSEVCSVHWR VSLWTLCTATCGNYGFQSRRVECVNARTNKAVPEHLCSWGPRPANWQRCNITPCENMECR DTTRYCEKVKQLKLCQLSQFKSRCCGTCGKA
Download sequence
Identical sequences	ENSEEUP00000003802 ENSEEUP00000003802

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]